You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameIL7R alpha protein (Fc Chimera)See all IL7R alpha proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 21-236 of Human IL7R alpha fused to the Fc region of Human IgG1 (aa 93- 330) expressed in modified Human 293 cells. Swiss ID = P16871.
  • Expression hostHEK 293 cells
  • Properties

  • Purity> 95 % by SDS-PAGE
  • FormLyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
  • Storage instructionsStore at +4°C.
  • Storage bufferPreservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS
  • Concentration information loading...
  • Sequence notesTheoretical Sequence: ESGYAQNGDLEDAELDDYSFSCYSQLEVN GSQHSLTCAFEDPDVNITNLEFEICGALVEVKCL NFRK LQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIV KPEAPFDLSVVYREGANDFVVT FNTSHLQKKYVKVLMH DVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKV RSIPDHY FKGFWSEWSPSYYFRTPEINNSSGGIPKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVL TVLHQDWLNGKEYKCRVSNKALP APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSP GK
  • Research Areas
  • Applications

    Our Abpromise guarantee covers the use of ab83827 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
  • Application notesSDS-PAGE: Use at an assay dependent dilution.

    Molecular Mass: ab83827 migrates as a broad band between 75 and 90 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares
    with the unmodified IL7R alpha-Fc Chimera that has a predicted molecular mass of 50.0kDa.

    pI: ab83827 separates into a number of isoforms with a pI between 5.9 and 7.4 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified IL7R alpha-Fc Chimera that has a predicted pI of 6.34.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Protein info

    • Alternative names
        CD 127CD127CD127 antigen
        CDW127IL 7RIL 7R alphaIL-7 receptor subunit alphaIL-7R subunit alphaIL-7R-alphaIL-7RAIL7RIL7RAIL7RA_HUMANIL7RalphaILRAInterleukin 7 receptorInterleukin 7 receptor alpha chainInterleukin 7 receptor isoform H5 6Interleukin-7 receptor subunit alpha
      see all
  • FunctionReceptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP).
  • Involvement in diseaseDefects in IL7R are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (T(-)B(+)NK(+) SCID) [MIM:608971]. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development.
    Genetic variations in IL7R are a cause of susceptibility to multiple sclerosis type 3 (MS3) [MIM:612595]. A multifactorial, inflammatory, demyelinating disease of the central nervous system. Sclerotic lesions are characterized by perivascular infiltration of monocytes and lymphocytes and appear as indurated areas in pathologic specimens (sclerosis in plaques). The pathological mechanism is regarded as an autoimmune attack of the myelin sheat, mediated by both cellular and humoral immunity. Clinical manifestations include visual loss, extra-ocular movement disorders, paresthesias, loss of sensation, weakness, dysarthria, spasticity, ataxia and bladder dysfunction. Genetic and environmental factors influence susceptibility to the disease. Note=A polymorphism at position 244 strongly influences susceptibility to multiple sclerosis. Overtransmission of the major 'C' allele coding for Thr-244 is detected in offspring affected with multiple sclerosis. In vitro analysis of transcripts from minigenes containing either 'C' allele (Thr-244) or 'T' allele (Ile-244) shows that the 'C' allele results in an approximately two-fold increase in the skipping of exon 6, leading to increased production of a soluble form of IL7R. Thus, the multiple sclerosis associated 'C' risk allele of IL7R would probably decrease membrane-bound expression of IL7R. As this risk allele is common in the general population, some additional triggers are probably required for the development and progression of MS.
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 1 fibronectin type-III domain.
  • DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Post-translational
    modifications
    N-glycosylated IL-7Ralpha binds IL7 300-fold more tightly than the unglycosylated form.
  • Cellular localizationSecreted and Cell membrane.
  • Target information above from: UniProt accession P16871 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    IL7R alpha protein (Fc Chimera) images

    • Densitometry of protein isoforms visualised by 2-DE.
      The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
      The triangle indicates the theoretical MW and pI of the protein.
    • 1D SDS-PAGE of ab83827 before and after treatment with glycosidases to remove oligosaccharides.
      Lane 1: ab83827
      Lane 2: ab83827 treated with PNGase F to remove potential N-linked glycans
      10 µg protein loaded per lane; Deep Purple™ stained.
      Drop in MW after treatment with PNGase F indicates presence of N-linked glycans.

    References for IL7R alpha protein (Fc Chimera) (ab83827)

    ab83827 has not yet been referenced specifically in any publications.

    Product Wall

    There are currently no Abreviews or Questions for ab83827.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"