You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Anti-Invadolysin antibody (ab58996)

CodeSizePriceAbpointsAvailability
    
 
  • -

  •   
  •   
  •   
  •  

  •  
  •  
  •  

  •  
Updating...

Reassurance, Refunds & Replacements

If your product does not perform as described on this datasheet, we will refund or replace your product...

Read our guarantee »

This product is covered by the Abpromise guarantee. Our scientific support team are available to answer any questions or queries - fill out an inquiry form for ab58996 for help.

Alternatively, you can search the previous enquiries about this product to see if your query has already been answered.

3 questions for ab58996

first page       

Page 1 of 1

     last page  

Question 1

Tuesday 03-April-2012

i ordered the antibody ab58996 and am preparing the review about the antibody GP63 (invasolysin). However, i just realized that i don't think I have a test discounting code. What should I do?

ANSWER:

 

Thank you for your email.
Please see below for your testing discount code. I am not sure if you had emailed me which antibody you were going to test. If so, then I did not receive this email. I'm sorry about that.

DISCOUNT CODE: xxx
Expiration date: xxx

I am very pleased to hear you would like to accept our offer and test ab58996 in pig. This code will give you 1 free PRIMARY ANTIBODY before the expiration date. To redeem this offer, please submit an Abreview for pigand include this code in the “Additional Comments” section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.

Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

The terms and conditions applicable to this offer can be found here: http://www.abcam.com/collaborationdiscount.

Question 2

Thursday 29-March-2012

So, I should try either ab58996,or ab59002. Do you have any preference? Is 83% good enough or it is borderline? Also, do I have to enroll in the testing discount program?

ANSWER:

 

Thank you for your reply.

My personal preference would be ab58996, since the immunogensequence is from the propeptide region (usually N-terminal) which aligns relatively well andthe sequence was covered in the pig sequence. For the other immunogen (of ab59002), I am not certain where the immunogen is located (stem region) and if it is covered in the pig sequence.

A homology of 83% is still good. We usually say a homology of 85% or higher has a good chance of cross reactivity. But this is only a theoretical prediction, and one will only know for sure after trying it out.

Once you let me know which antibody you would like to try in pig samples, I'd be happy to send you the testing discount code for that antibody. There is no formal sign-upfor the testing program.

I hope this information is helpful to you. Please let me know which antibody you would be interested in trying.
Please do not hesitate to contact me if you need any more advice or information.

Question 3

Wednesday 28-March-2012

that is the pig amino acid sequence i got (incomplete). It is the most n-terminal
since start with ann ATG:
MVTTLGLKMAAELGRGEGSRGPGRGPSQWHWSGSLWIRGVLLLLGGLRASATSIPVYLGN
SPPCRHHVPSDSEVINKVHLKANHIVRRDVNEHLRIKTVYDKSIEELLPEKRYLVKNKLF
PQAVSYLEKTFQVRRPAGTILLSRQCATNQYQYLRKENDHHRCCTEECAEHTKCGPVIVP
EEHLQ

ANSWER:

 

Thank you for your email.

The overall sequence homology between the human and the (incomplete) pig Invadolysin protein is 83%. The incomplete pig sequence covers only 1/3 of the human sequence.

For all 4 invadolysin antibodies (ab58996, ab58997, ab59001, ab59002), we do not have information about theimmunogen sequence as this information is made proprietary by the originators of the antibodies.

For ab58997, the immunogenwas selected from the catalytic domain,however this region is not included in the pig sequence you sent, thus I am not sure how high the homology between human and pig would be. This is also the case for ab59001.

If you would like to try one of the antibodies, youwould beeligible to use our testing discount program as detailed below.

For UNTESTED species and/or applications, we have established a testing discount program. Here is a brief description of how it works:
The testing discount program is for customers who like to use an antibody/protein on an untested species/application. You would purchase the antibody at full price, test it and submit an Abreview with your data (positive or negative). On your next order you will receive a discount for ONE antibody at the full price (100%) of the antibody you have tested. The terms and conditions applicable to this offer can be found here: http://www.abcam.com/collaborationdiscount.

Please let me know if I shall send you a testing discount code for one of the antibodies to try it in pig samples.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

first page       

Page 1 of 1

     last page  

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"