You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Anti-Invadolysin antibody (ab58996)

Abreviews (1)Q&A (6)

Overview

  • Product nameAnti-Invadolysin antibodySee all Invadolysin primary antibodies ...
  • Description
    Rabbit polyclonal to Invadolysin
  • Specificityab58996 recognizes all but the shortest form of human Invadolysin. We have a range of domain specific antibodies for this target. For a full list please see all Invadolysin antibodies.
  • Tested applicationsWB more details
  • Species reactivity
    Reacts with: Human, Pig
  • Immunogen

    Synthetic peptide based on the propeptide domain of human Invadolysin. Immunizing peptide available on request, please contact a customer service representative to ask for availability.

Properties

Applications

Our Abpromise guarantee covers the use of ab58996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB
  • Application notesWB: 1/1000 - 1/5000 dependent on substrate. Predicted molecular weight: 74 kDa.
    A recommended starting concentration for Western blots is 1:1,000 when using colorimetric substrates such as BCIP/NBT, and 1:5,000 for chemiluminescent substrates.

    EDTA/EGTA treatment of tissues or lysates is required to see latent zymogen.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Target

    • RelevanceInvadolysin, also known as Leismanolysin-Like proteinase, is a metalloproteinase of the MA clan, family M8, which is distinguished from the other families of metalloproteinases by an insert in the zinc binding site. The “classical” zinc binding motif of HExxHxxxxH contains an insert of 65 residues in the Leishmania form of Leishmanolysin, and varies from 62-105 residues amongst different parasite leishmanolysin isoforms.
    • Cellular localizationCytoplasmic
    • Database links
      • Alternative names
          Gp63 antibodyGP63 like antibodyINV antibody
          IX14 antibodyLeishmanolysin Like Peptidase antibodyleishmanolysin-like (metallopeptidase M8 family) antibodyLMLN antibodyMsp antibody
        see all

      Anti-Invadolysin antibody images

      • Western blot - Invadolysin antibody (ab58996)
        Western blot - Invadolysin antibody (ab58996)
        All lanes : Anti-Invadolysin antibody (ab58996) at 1/1000 dilution

        Lane 1 : Cell media from epithelial carcinoma A-431(treated with SF)
        Lane 2 : Cell media from human epithelial carcinoma A-431 (treated with TPA)
        Lane 3 : Cell media from human epithelial carcinoma A-431(treated with RA)

        Lysates/proteins at 20 µl per lane.


        Predicted band size : 74 kDa

      References for Anti-Invadolysin antibody (ab58996)

      ab58996 has not yet been referenced specifically in any publications.

      Publishing research using ab58996 ? Please let us know so that we can cite the reference in this datasheet

      Product Wall

      Submit an Abreview for ab58996 Submit a Question for ab58996

      Displaying 1 - 7 of 7 results for Abreviews and Q&A

      10
      Votes: Highest First

      Yes, I am interested; so please send me testing discount code for use of ab25630 with pig samples.


      I am very pleased to hear you would like to accept our offer and test ab25630 in pig. This code will give you: 1 free PRIMARY ANTIBODY OR COST OF PRODUCT OFF OF ORDER before the expiration date. To redeem this offer, please submit an Abreview for pig...

      Read More

      I am looking for a lysosomal marker that works in pigs and rat cells/tissues.

      Thanks for your email.

      I have checked our lysosomal marker antibodies, which include antibodies to Lamp1 and Lamp2. I was not able to find an antibody that fits all your needs based on tested species and applications. However I think a few come ...

      Read More

      I just realized that this promotion expired. Can i get an extension?

      Thanks for your email.

      Here is a new discount code and expiration date to test ab58996 in pig:


      I hope this is helpful. Please contact me again if you have any further questions.

      Western blot abreview for Anti-Invadolysin antibody

       Good
      Abreviews
      Application Western blot
      Sample Pig Tissue lysate - whole (Heart - Left Ventricle)
      Loading amount 40 µg
      Specification Heart - Left Ventricle
      Gel Running Conditions Reduced Denaturing (4%-12%)
      Blocking step BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1.5% · Temperature: RT°C
      Read More
      abreview image
      Username

      Verified customer

      Submitted Apr 20 2012

      i ordered the antibody ab58996 and am preparing the review about the antibody GP63 (invasolysin). However, i just realized that i don't think I have a test discounting code. What should I do?

      Thank you for your email.
      Please see below for your testing discount code. I am not sure if you had emailed me which antibody you were going to test. If so, then I did not receive this email. I'm sorry about that.

      DISCOUNT CODE: xxx
      Ex...

      Read More

      So, I should try either ab58996,or ab59002. Do you have any preference? Is 83% good enough or it is borderline? Also, do I have to enroll in the testing discount program?

      Thank you for your reply.

      My personal preference would be ab58996, since the immunogensequence is from the propeptide region (usually N-terminal) which aligns relatively well andthe sequence was covered in the pig sequence. For the other immuno...

      Read More

      that is the pig amino acid sequence i got (incomplete). It is the most n-terminal
      since start with ann ATG:
      MVTTLGLKMAAELGRGEGSRGPGRGPSQWHWSGSLWIRGVLLLLGGLRASATSIPVYLGN
      SPPCRHHVPSDSEVINKVHLKANHIVRRDVNEHLRIKTVYDKSIEELLPEKRYLVKNKLF
      PQAVS...

      Read More

      Thank you for your email.

      The overall sequence homology between the human and the (incomplete) pig Invadolysin protein is 83%. The incomplete pig sequence covers only 1/3 of the human sequence.

      For all 4 invadolysin antibodies (ab5899...

      Read More

      Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"