Anti-KAT4 / TBP Associated Factor 1 antibody (ab24427)

Overview

• Product nameAnti-KAT4 / TBP Associated Factor 1 antibodySee all KAT4 / TBP Associated Factor 1 primary antibodies ...
• Description
  Mouse polyclonal to KAT4 / TBP Associated Factor 1
• Tested applicationsWB more details
• Species reactivity
  Reacts with: Saccharomyces cerevisiae
  
• Immunogen

  Fusion protein: LSNDDKYQILKKTHQTKVRSTISNLNIQHSQPAINLQSPF YKVAVPRYQLRHFHRENFGSHIRPGTKIVFSKLKARKRKR DKGKDVKESFSTSQDLTIGD, corresponding to amino acids 441/540 of Saccharomyces cerevisiae TAF1

  Run BLAST with Run BLAST with
• General notesProduced from outbred CD1 mice

  
  

  This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

• FormLiquid
• Storage instructionsStore at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
• Storage bufferPreservative: None
  Constituents: 50% Glycerol
• PurityWhole antiserum
• Primary antibody notes This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
• Clonality Polyclonal
• IsotypeIgG
• Research Areas
  • Epigenetics and Nuclear Signaling
  • Transcription
  • Co-factors

  • Epigenetics and Nuclear Signaling
  • Transcription
  • Polymerase associated factors
  • Pol II Transcription
  • TFIID

  • Epigenetics and Nuclear Signaling
  • Chromatin Modifying Enzymes
  • Acetylation
  • HAT

Applications

Target

• FunctionLargest component and core scaffold of the TFIID basal transcription factor complex. Contains novel N- and C-terminal Ser/Thr kinase domains which can autophosphorylate or transphosphorylate other transcription factors. Phosphorylates TP53 on 'Thr-55' which leads to MDM2-mediated degradation of TP53. Phosphorylates GTF2A1 and GTF2F1 on Ser residues. Possesses DNA-binding activity. Essential for progression of the G1 phase of the cell cycle.
• Involvement in diseaseDefects in TAF1 are the cause of dystonia type 3 (DYT3) [MIM:314250]; also called X-linked dystonia-parkinsonism (XDP). DYT3 is a X-linked dystonia-parkinsonism disorder. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. DYT3 is characterized by severe progressive torsion dystonia followed by parkinsonism. Its prevalence is high in the Philippines. DYT3 has a well-defined pathology of extensive neuronal loss and mosaic gliosis in the striatum (caudate nucleus and putamen) which appears to resemble that in Huntington disease.
• Sequence similaritiesBelongs to the TAF1 family.
  Contains 2 bromo domains.
  Contains 1 HMG box DNA-binding domain.
  Contains 2 protein kinase domains.
• Post-translational
  modificationsPhosphorylated by casein kinase II in vitro.
• Cellular localizationNucleus.

Target information above from: UniProt accession P21675 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt
• Database links
  • Entrez Gene: 853191 Saccharomyces cerevisiae
  • SwissProt: P46677 Saccharomyces cerevisiae

• Alternative names
  BA2R antibodyCCG 1 antibodyCCG1 antibody

  CCGS antibodyCell cycle G1 phase defect antibodyCell cycle gene 1 protein antibodyComplementation of cell cycle block G1 to S antibodyDYT3 antibodyDYT3 protein antibodyN TAF1 antibodyNSCL 2 antibodyNSCL2 antibodyOF antibodyp250 antibodyTAF 1 antibodyTAF 2A antibodyTAF(II)250 antibodyTAF1 antibodyTAF1 RNA polymerase II TATA box binding protein (TBP) associated factor 250kDa antibodyTAF1 RNA polymerase II TATA box binding protein (TBP) associated factor antibodyTAF1 RNA polymerase II TATA box binding protein associated factor 250kDa antibodyTAF1_HUMAN antibodyTAF2A antibodyTAFII 250 antibodyTAFII-250 antibodyTAFII250 antibodyTATA box binding protein (TBP) associated factor RNA polymerase II A antibodyTATA box binding protein (TBP) associated factor RNA polymerase II A 250kD antibodyTBP associated factor 250 kDa antibodyTBP-associated factor 250 kDa antibodyTranscription factor TFIID p250 polypeptide antibodyTranscription initiation factor TFIID 250 kDa subunit antibodyTranscription initiation factor TFIID subunit 1 antibodyXDP antibody

  see all

Anti-KAT4 / TBP Associated Factor 1 antibody images

• 

  Western blot - TAF1 antibody (ab24427)
  All lanes : Anti-KAT4 / TBP Associated Factor 1 antibody (ab24427) at 1/1000 dilution
  
  Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
  Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug
  
  Secondary
  Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution
  
  Predicted band size : 120 kDa