Overview

  • Product nameAnti-KLHL20 antibodySee all KLHL20 primary antibodies ...
  • Description
    Rabbit polyclonal to KLHL20
  • Tested applicationsWBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Fruit fly (Drosophila melanogaster), Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 481-530 (

    NPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPR

    ) of Human KLHL20 (NP_055273).

  • Positive control
    • HeLa cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab108238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 68 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionSubstrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex involved in interferon response. The BCR(KLHL20) E3 ubiquitin ligase complex mediates the ubiquitination of DAPK1, leading to its degradation by the proteasome, thereby acting as a negative regulator of apoptosis. Also acts as a regulator of endothelial migration during angiogenesis by controlling the activation of Rho GTPases.
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesContains 1 BACK (BTB/Kelch associated) domain.
    Contains 1 BTB (POZ) domain.
    Contains 6 Kelch repeats.
  • Cellular localizationCytoplasm > perinuclear region. Nucleus. Localizes in the perinuclear region in normal conditions. Following IFN-alpha or IFN-gamma treatment, it is relocalized and sequestrated to the PML nuclear bodies, preventing DAPK1 ubiquitination.
  • Information by UniProt
  • Database links
  • Alternative names
    • Kelch like ECT2 interacting protein antibody
    • Kelch like protein 20 antibody
    • Kelch like protein X antibody
    • Kelch motif containing protein antibody
    • Kelch-like ECT2-interacting protein antibody
    • Kelch-like protein 20 antibody
    • Kelch-like protein X antibody
    • KHLHX antibody
    • KLEIP antibody
    • KLH20_HUMAN antibody
    • KLHL20 antibody
    • KLHLX antibody
    • RP3-383J4.3 antibody
    see all

Anti-KLHL20 antibody images



  • Predicted band size : 68 kDa
    Western blot analysis of MCF7 cell lysate labeling KLHL20 with ab108238 at 1.0µg/ml.
  • Anti-KLHL20 antibody (ab108238) at 1 µg/ml + HeLa Cell Lysate at 10 µg

    Predicted band size : 68 kDa
    12% SDS PAGE

References for Anti-KLHL20 antibody (ab108238)

ab108238 has not yet been referenced specifically in any publications.

Product Wall

Application Western blot
Sample Human Cell lysate - whole cell (Human osteosarcoma U2OS cells)
Loading amount 90 µg
Specification Human osteosarcoma U2OS cells
Gel Running Conditions Reduced Denaturing (4-18% gel)
Blocking step BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Apr 11 2012

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"