You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

KMT1D / GLP / Eu HMTase1 protein (Tagged-His Tag) (ab91840)

Submit an Abreview Submit a Question

Overview

  • Product nameKMT1D / GLP / Eu HMTase1 protein (Tagged-His Tag)
  • Protein descriptionRecombinant fragment, corresponding to amino acids 460-716 of Human KMT1D / GLP / Eu HMTase1 with N terminal His tag; 257 amino acids, 38kDa (29.2kDa predicted from sequence). UniProt ID = Q9H9B1.
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 103 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Sequence notesSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMR CWYDKDGRLLPEFNMAEPP LIFECNHACSCWRNCRNRV VQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGEL ISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSR FINHHCEPNLVPVRVFMAHQD LRFPRIAFFSTRLIEAG EQLGFDYGERFWDIKGKLFSCRCGSPKCRHSSAALAQRQA SA AQEAQEDGLPDTSSAAAADPL
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab91840 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
    MS
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        bA188C12.1DKFZp667M072EHMT 1
        EHMT1EHMT1_HUMANEu-HMTase1Euchromatic histone lysine N methyltransferase 1Euchromatic histone methyltransferase 1Euchromatic histone-lysine N-methyltransferase 1EUHMTASE1FLJ12879FP13812G9a like proteinG9a like protein 1G9a-like protein 1GLPGLP 1GLP1H3 K9 HMTase 5H3-K9-HMTase 5Histone H3 K9 methyltransferase 5Histone H3-K9 methyltransferase 5Histone lysine N methyltransferase H3 lysine 9 specific 5Histone-lysine N-methyltransferase EHMT1KIAA1876Lysine N methyltransferase 1DLysine N-methyltransferase 1DRP11 188C12.1
      see all
  • FunctionHistone methyltransferase that specifically mono- and dimethylates 'Lys-9' of histone H3 (H3K9me1 and H3K9me2, respectively) in euchromatin. H3K9me represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. Also weakly methylates 'Lys-27' of histone H3 (H3K27me). Also required for DNA methylation, the histone methyltransferase activity is not required for DNA methylation, suggesting that these 2 activities function independently. Probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1. During G0 phase, it probably contributes to silencing of MYC- and E2F-responsive genes, suggesting a role in G0/G1 transition in cell cycle. In addition to the histone methyltransferase activity, also methylates non-histone proteins: mediates dimethylation of 'Lys-373' of p53/TP53.
  • Tissue specificityWidely expressed.
  • Involvement in diseaseDefects in EHMT1 are the cause of chromosome 9q subtelomeric deletion syndrome (9q- syndrome) [MIM:610253]. Common features seen in these patients are severe mental retardation, hypotonia, brachy(micro)cephaly, epileptic seizures, flat face with hypertelorism, synophrys, anteverted nares, cupid bow or tented upper lip, everted lower lip, prognathism, macroglossia, conotruncal heart defects, and behavioral problems.
  • Sequence similaritiesBelongs to the histone-lysine methyltransferase family.
    Contains 8 ANK repeats.
    Contains 1 pre-SET domain.
    Contains 1 SET domain.
  • DomainThe ANK repeats recognize and bind RELA subunit of NF-kappa-B, when RELA is monomethylated at 'Lys-310' (By similarity). They also specifically recognize and bind H3K9me1 and H3K9me2.
    The SET domain mediates interaction with WIZ.
  • Post-translational
    modifications    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus. Chromosome. Associates with euchromatic regions.

    • Target information above from: UniProt accession Q9H9B1 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    KMT1D / GLP / Eu HMTase1 protein (Tagged-His Tag) images

    • SDS-PAGE - KMT1D / GLP / Eu HMTase1 protein (Tagged-His Tag) (ab91840)
      SDS-PAGE - KMT1D / GLP / Eu HMTase1 protein (Tagged-His Tag) (ab91840)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for KMT1D / GLP / Eu HMTase1 protein (Tagged-His Tag) (ab91840)

    ab91840 has not yet been referenced specifically in any publications.

    Publishing research using ab91840 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab91840 Submit a Question for ab91840

    There are currently no Abreviews or Questions for ab91840.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"