You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Kidins220 protein (Tagged-His Tag) (ab92033)

Submit an Abreview Submit a Question

Overview

  • Product nameKidins220 protein (Tagged-His Tag)
  • Protein descriptionRecombinant fragment, corresponding to amino acids 1604-1771 (168 amino acids) of Human Kidins220 with an N terminal His tag. MW 38 kDa (predicted MW: 20 kDa); UniProt ID: Q9ULH0.
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 78 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Sequence notesADDSQLEKANLIELEDDSHSGKRGIPHSLSGLQDPIIARM SICSEDKKSPSECSLIA SSPEENWPACQKAYNLNRTPS TVTLNNNSAPANRANQNFDEMEGIRETSQVILRPSS SP NPTTIQNENLKSMTHKRSQRSSYTRLSKDPPELHAAASSE STGFGEERESIL
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab92033 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    MS
    SDS-PAGE
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        Ankyrin repeat-rich membrane-spanning proteinarmsKDIS_HUMAN
        Kidins220Kinase D interacting substance of 220 kDaKinase D-interacting substrate of 220 kDargd 619949
      see all
  • FunctionPromotes a prolonged MAP-kinase signaling by neurotrophins through activation of a Rap1-dependent mechanism. Provides a docking site for the CRKL-C3G complex, resulting in Rap1-dependent sustained ERK activation. May play an important role in regulating postsynaptic signal transduction through the syntrophin-mediated localization of receptor tyrosine kinases such as EPHA4. In cooperation with SNTA1 can enhance EPHA4-induced JAK/STAT activation. May play a role in neurotrophin- and ephrin-mediated neuronal outgrowth and in axon guidance during neural development and in neuronal regeneration (By similarity). Modulates stress-induced apoptosis of melanoma cells via regulation of the MEK/ERK signaling pathway.
  • Tissue specificityAbundant in developing and adult neural tissues as well as neuroendocrine cells and dendritic cells. Overexpressed in melanoma and melanoma cell lines.
  • Sequence similaritiesContains 12 ANK repeats.
    Contains 1 KAP NTPase domain.
  • DomainThe transmembrane domain mediates interaction with NTRK1.
  • Post-translational
    modifications    Tyrosine phosphorylated by NTRK1, NTRK2, EPHB2 and EPHA4. Phosphorylation at Ser-918 is induced by phorbol ester treatment. Phosphorylation by NTRK2 is induced by brain-derived neurotrophic factor (BDNF) and neurotrophin-4/5. Phosphorylation by NTRK1 is induced by nerve growth factor (NGF).
  • Cellular localizationMembrane.

    • Target information above from: UniProt accession Q9ULH0 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    Kidins220 protein (Tagged-His Tag) images

    • SDS-PAGE - Kidins220 protein (Tagged-His Tag) (ab92033)
      SDS-PAGE - Kidins220 protein (Tagged-His Tag) (ab92033)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for Kidins220 protein (Tagged-His Tag) (ab92033)

    ab92033 has not yet been referenced specifically in any publications.

    Publishing research using ab92033 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab92033 Submit a Question for ab92033

    There are currently no Abreviews or Questions for ab92033.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"