You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameL1CAM protein (Tagged-His Tag)
  • Protein descriptionRecombinant fragment, corresponding to amino acids 605-1065 of Human L1CAM with an N-terminal His tag; MWt 53 kDa (UniProt P32004).
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 58 µl aqua dest
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Sequence notes(Amino acid sequence (Sequence determined by 5' Sequencing))
    QLLVVGSPGPVPRLVLSDLHLLTQSQ VRVSWSPAEDHNAPIEKYDIEFEDK EMAPEKWYSLGKV PGNQTSTTLKLSPYVHYTFRVTAINKYGPGEPSPVSET VVTPEAAPEKNPVDVKGEGNETTNMVITWKPLRWMDWNAP QVQYRVQWRPQ GTRGPWQEQIVSDPFLVVSNTSTFVPY EIKVQAVNSQGKGPEPQVTIGYSG EDYPQAIPELEGIE ILNSSAVLVKWRPVDLAQVKGHLRGYNVTYWREGSQR K HSKRHIHKDHVVVPANTTSVILSGLRPYSSYHLEVQAFNG RGSGPASEFT FSTPEGVPGHPEALHLECQSNTSLLLRW QPPLSHNGVLTGYVLSYHPLDEG GKGQLSFNLRDPELR THNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTM AL SGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKAL GEEKGGASL SP
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab91697 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    MS
    SDS-PAGE
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        Antigen identified by monoclonal antibody R1CAML1CD171
        CD171 antigenHSASHSAS1HydL1L1 cell adhesion moleculeL1-NCAML1camL1CAM_HUMANMASAMIC5N CAML1N-CAM-L1NCAM-L1NCAML1Nerve-growth factor-inducible large external glycoproteinNeural cell adhesion molecule L1NILEOTTHUMP00000025992S10SPG1
      see all
  • FunctionCell adhesion molecule with an important role in the development of the nervous system. Involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc. Binds to axonin on neurons.
  • Involvement in diseaseDefects in L1CAM are the cause of hydrocephalus due to stenosis of the aqueduct of Sylvius (HSAS) [MIM:307000]. Hydrocephalus is a condition in which abnormal accumulation of cerebrospinal fluid in the brain causes increased intracranial pressure inside the skull. This is usually due to blockage of cerebrospinal fluid outflow in the brain ventricles or in the subarachnoid space at the base of the brain. In children is typically characterized by enlargement of the head, prominence of the forehead, brain atrophy, mental deterioration, and convulsions. In adults the syndrome includes incontinence, imbalance, and dementia. HSAS is characterized by mental retardation and enlarged brain ventricles.
    Defects in L1CAM are the cause of mental retardation-aphasia-shuffling gait-adducted thumbs syndrome (MASA) [MIM:303350]; also known as corpus callosum hypoplasia, psychomotor retardation, adducted thumbs, spastic paraparesis, and hydrocephalus or CRASH syndrome. MASA is an X-linked recessive syndrome with a highly variable clinical spectrum. Main clinical features include spasticity and hyperreflexia of lower limbs, shuffling gait, mental retardation, aphasia and adducted thumbs. The features of spasticity have been referred to as complicated spastic paraplegia type 1 (SPG1). Some patients manifest corpus callosum hypoplasia and hydrocephalus. Inter- and intrafamilial variability is very wide, such that patients with hydrocephalus, MASA, SPG1, and agenesis of corpus callosum can be present within the same family.
    Defects in L1CAM are the cause of spastic paraplegia X-linked type 1 (SPG1) [MIM:303350]. Spastic paraplegia is a degenerative spinal cord disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs.
    Note=Defects in L1CAM may contribute to Hirschsprung disease by modifying the effects of Hirschsprung disease-associated genes to cause intestinal aganglionosis.
    Defects in L1CAM are a cause of partial agenesis of the corpus callosum (ACCPX) [MIM:304100]. A syndrome characterized by partial corpus callosum agenesis, hypoplasia of inferior vermis and cerebellum, mental retardation, seizures and spasticity. Other features include microcephaly, unusual facies, and Hirschsprung disease in some patients.
  • Sequence similaritiesBelongs to the immunoglobulin superfamily. L1/neurofascin/NgCAM family.
    Contains 5 fibronectin type-III domains.
    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localizationCell membrane.

    • Target information above from: UniProt accession P32004 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    L1CAM protein (Tagged-His Tag) images

    • SDS-PAGE - L1CAM protein (Tagged-His Tag) (ab91697)
      SDS-PAGE - L1CAM protein (Tagged-His Tag) (ab91697)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for L1CAM protein (Tagged-His Tag) (ab91697)

    ab91697 has not yet been referenced specifically in any publications.

    Publishing research using ab91697 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab91697 Submit a Question for ab91697

    There are currently no Abreviews or Questions for ab91697.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"