You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

MASH1/Achaete-scute homolog 1 protein (ab114273)

Submit an Abreview Submit a Question

Overview

  • Product nameMASH1/Achaete-scute homolog 1 proteinSee all MASH1/Achaete-scute homolog 1 proteins and peptides ...
  • Protein descriptionRecombinant fragment corresponding to amino acids 137-236 of Human MASH1/Achaete-scute homolog 1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa (UniProt P50553).
  • Uniprot accessionP50553
  • Molecular weight36.630kDa inclusive of tags
  • Protein length100 amino acids
  • Expression hostWheat germ

    • Properties

  • FormLiquid
  • Storage instructionsShipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferpH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl
  • Concentration information loading...
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • SequenceGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDE HDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDE GSYDPLSPEEQELLDFTNWF
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab114273 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    ELISA ELISA: Use at an assay dependent concentration.
    SDS-PAGE SDS-PAGE: Use at an assay dependent concentration.
    WB WB: Use at an assay dependent concentration. (recombinant protein).

    Protein info

    • Alternative names
        Achaete scute complex homolog 1Achaete scute complex homolog like 1Achaete scute complex homologue 1
        Achaete scute complex homologue like 1Achaete scute complex like 1Achaete scute proteinAchaete-scute homolog 1Ascl 1ascl1ASCL1_HUMANAsh 1ASH-1Ash1bHLHa46Class A basic helix-loop-helix protein 46Hash 1HASH1Mammalian achaete scute homolog 1Mammalian achaete scute homologue 1Mash 1Mash1
      see all
  • FunctionMay play a role at early stages of development of specific neural lineages in most regions of the CNS, and of several lineages in the PNS. Essential for the generation of olfactory and autonomic neurons. Activates transcription by binding to the E box (5'-CANNTG-3').
  • Sequence similaritiesContains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localizationNucleus.

    • Target information above from: UniProt accession P50553 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    MASH1/Achaete-scute homolog 1 protein images

    • SDS-PAGE - MASH1/Achaete-scute homolog 1 protein (ab114273)
      SDS-PAGE - MASH1/Achaete-scute homolog 1 protein (ab114273)
      12.5% SDS-PAGE analysis of ab114273 stained with Coomassie Blue.

    References for MASH1/Achaete-scute homolog 1 protein (ab114273)

    ab114273 has not yet been referenced specifically in any publications.

    Publishing research using ab114273 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab114273 Submit a Question for ab114273

    There are currently no Abreviews or Questions for ab114273.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"