You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameMDMX proteinSee all MDMX proteins and peptides ...
  • Protein descriptionRecombinant fragment of Human MDMX (amino acids 381-490) with N terminal proprietary tag; predicted MWt 37.73 kDa including the tag (UniProt Id: O15151).
  • Uniprot accessionO15151
  • Molecular weight37.730kDa inclusive of tags
  • Protein length110 amino acids
  • Expression hostWheat germ

    • Properties

  • FormLiquid
  • Storage instructionsShipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferpH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione
  • Concentration information loading...
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114468 is best used within three months from the date of receipt.
  • Sequence notesENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQ RTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTC FHCARRLKKAGASCPICKKEIQLVIKVFIA
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab114468 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    WB WB: Use at an assay dependent concentration.
    SDS-PAGE SDS-PAGE: Use at an assay dependent concentration.
    ELISA ELISA: Use at an assay dependent concentration.

    Protein info

    • Alternative names
        DKFZp781B1423Double minute 4Double minute 4 human homolog of p53 binding protein
        Double minute 4 proteinHDMXMDM 4Mdm2 like p53 binding proteinMdm2-like p53-binding proteinMDM4Mdm4 p53 binding protein homolog mouseMdm4 proteinMDM4 related protein 1Mdm4 transformed 3T3 cell double minute 4Mdm4 transformed 3T3 cell double minute 4 p53 binding proteinMdm4 transformed 3T3 cell double minute 4 p53 binding protein mouseMDM4_HUMANMdmx proteinMGC132766Mouse double minute 4 homologMouse double minute 4 human homolog of p53 binding proteinMRP 1MRP1p53 binding proteinp53 BINDING PROTEIN MDM4p53-binding protein Mdm4Protein Mdm4Protein Mdmx
      see all
  • FunctionInhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions.
  • Tissue specificityExpressed in all tissues tested with high levels in thymus.
  • Sequence similaritiesBelongs to the MDM2/MDM4 family.
    Contains 1 RanBP2-type zinc finger.
    Contains 1 RING-type zinc finger.
    Contains 1 SWIB domain.
  • DomainRegion I is sufficient for binding TP53 and inhibiting its G1 arrest and apoptosis functions. It also binds TP73. Region II contains most of a central acidic region and a putative C4-type zinc finger. The RING finger domain which coordinates two molecules of zinc mediates the heterooligomerization with MDM2.
  • Post-translational
    modifications    Ubiquitinated. Deubiquitinated by USP2; leading to stabilize it.
  • Cellular localizationNucleus.

    • Target information above from: UniProt accession O15151 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    MDMX protein images

    • SDS-PAGE - MDMX protein (ab114468)
      SDS-PAGE - MDMX protein (ab114468)
      ab114468 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

    References for MDMX protein (ab114468)

    ab114468 has not yet been referenced specifically in any publications.

    Publishing research using ab114468 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab114468 Submit a Question for ab114468

    There are currently no Abreviews or Questions for ab114468.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"