
  • Product nameAnti-MEMO1 antibodySee all MEMO1 primary antibodies ...
  • Description
    Rabbit polyclonal to MEMO1
  • Tested applicationsWB more details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 143-192 (AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFC H) of Human MEMO1 (NP_057039).

  • Positive control
    • Human fetal Heart Lysate



Our Abpromise guarantee covers the use of ab98158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-MEMO1 antibody images

  • Anti-MEMO1 antibody (ab98158) at 1 µg/ml + Human fetal Heart Lysate at 10 µg

    Predicted band size : 34 kDa

References for Anti-MEMO1 antibody (ab98158)

ab98158 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98158.
Please use the links above to contact us or submit feedback about this product.