Overview
- Product nameAnti-MEMO1 antibodySee all MEMO1 primary antibodies ...
- DescriptionRabbit polyclonal to MEMO1
- Tested applicationsWB more details
- Species reactivityReacts with: Human
Predicted to work with: Mouse, Rat - Immunogen
Synthetic peptide corresponding to a region within internal amino acids 143-192 (AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPS NLFVVSSDFCH) of Human MEMO1 (NP_057039).
- Positive controlHuman fetal Heart Lysate
Properties
- FormLiquid
- Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
- Storage bufferPreservative: None
Constituents: 2% Sucrose, PBS -
Concentration information loading... - PurityImmunogen affinity purified
- Clonality Polyclonal
- IsotypeIgG
- Research Areas
Applications
Our Abpromise guarantee covers the use of ab98158 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Notes |
|---|---|
| WB | WB: Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T. |
Target
- FunctionMay control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. Mediator of ERBB2 signaling. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Is required for breast carcinoma cell migration.
- Sequence similaritiesBelongs to the UPF0103 family.
-
Database links
- Entrez Gene: 51072 Human
- Entrez Gene: 76890 Mouse
- Entrez Gene: 298787 Rat
- Omim: 611786 Human
- SwissProt: Q9Y316 Human
- SwissProt: Q91VH6 Mouse
- SwissProt: Q4QQR9 Rat
- Unigene: 444969 Human
- Unigene: 311874 Mouse
- Unigene: 22312 Rat
see all
Target information above from: UniProt accession
Q9Y316
The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010)
.
-
Alternative names
- C21orf19-like protein antibodyC2orf4 antibodyCGI 27 antibody
- DKFZp434I0135 antibodyFLJ25031 antibodyHCV NS5A-transactivated protein 7 antibodyHepatitis C virus NS5A-transactivated protein 7 antibodyMediator of cell motility 1 antibodyMediator of ErbB2-driven cell motility 1 antibodyMEMO antibodyMemo-1 antibodymemo1 antibodyMEMO1_HUMAN antibodyNS5ATP7 antibodyProtein MEMO1 antibody
see all
Anti-MEMO1 antibody images
-
Western blot - MEMO1 antibody (ab98158)Anti-MEMO1 antibody (ab98158) at 1 µg/ml + Human fetal Heart Lysate at 10 µg
Predicted band size : 34 kDa
References for Anti-MEMO1 antibody (ab98158)
ab98158 has not yet been referenced specifically in any publications.
