Overview

  • Product nameAnti-MEMO1 antibody
    See all MEMO1 primary antibodies
  • Description
    Rabbit polyclonal to MEMO1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 143-192 (

    AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH

    ) of Human MEMO1 (NP_057039).

  • Positive control
    • Human fetal Heart Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab98158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. Mediator of ERBB2 signaling. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Is required for breast carcinoma cell migration.
  • Sequence similaritiesBelongs to the MEMO1 family.
  • Information by UniProt
  • Database links
  • Alternative names
    • C21orf19-like protein antibody
    • C2orf4 antibody
    • CGI 27 antibody
    • DKFZp434I0135 antibody
    • FLJ25031 antibody
    • HCV NS5A-transactivated protein 7 antibody
    • Hepatitis C virus NS5A-transactivated protein 7 antibody
    • Mediator of cell motility 1 antibody
    • Mediator of ErbB2-driven cell motility 1 antibody
    • MEMO antibody
    • Memo-1 antibody
    • memo1 antibody
    • MEMO1_HUMAN antibody
    • NS5ATP7 antibody
    • Protein MEMO1 antibody
    see all

Anti-MEMO1 antibody images

  • Anti-MEMO1 antibody (ab98158) at 1 µg/ml + Human fetal Heart Lysate at 10 µg

    Predicted band size : 34 kDa

References for Anti-MEMO1 antibody (ab98158)

ab98158 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"