Anti-MOBP antibody (ab66253)

Overview

  • Product nameAnti-MOBP antibodySee all MOBP primary antibodies ...
  • Description
    Mouse monoclonal to MOBP
  • Tested applicationsWB, ELISA more details
  • Species reactivity
    Reacts with: Recombinant Fragment
    Predicted to work with: Human
  • Immunogen

    Recombinant full length protein (Human, AAH22471, 1 a.a. ~ 82 a.a) with tag. MW of the tag alone is 26 kDa. MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSG CFYQKKEEDWICCACQKTRLKRKIRPTPKKK

  • Positive control
    • Full length recombinant MOBP with tag.

Properties

Applications

Our Abpromise guarantee covers the use of ab66253 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB 1/500 - 1/1000. Predicted molecular weight: 21 kDa. This antibody has only been tested in WB against the recombinant protein used as immunogen. We have no data on the detection of endogenous protein.
ELISA Use at an assay dependent dilution.

Target

  • RelevanceMOBP (Myelin-associated oligodendrocytic basic protein) is abundantly expressed specifically in oligodendrocytes and is the third most abundant protein in CNS myelin. MOBP is present in the major dense line of CNS myelin suggesting a role in the compaction or stabilization of myelin.
  • Cellular localizationCytoplasmic
  • Database links
  • Alternative names
    • MGC87379 antibody
    • Myelin associated oligodendrocyte basic protein antibody

Anti-MOBP antibody images



  • Predicted band size : 21 kDa

References for Anti-MOBP antibody (ab66253)

ab66253 has not yet been referenced specifically in any publications.

Product Wall

Thank you very much for sending this information. I am sorry that these antibodies did not work as expected. I have issued the credits to Cedarlane, and I will contact them to pass these credits on to you. Please let me know if you have...

Read More

Thanks so much for forwarding the images. I am sorry to see that the results were so poor. Could you also send the general protocol that was used? As mentioned previously, I can send replacements or issue credit or refunds for the integrin beta...

Read More

Thanks for your reply and for clarifying that, and I look forward to receiving any data or images that you can provide. Please let me know if you need anything else from me.

Thank you very much for your replies and for sending the information. I am sorry to hear that none of these antibodies gave the expected results. Just to clarify, there were no bands in Western blot even with the human protein samples? We do guarantee ...

Read More

Thank you for your inquiry and I'm sorry to hear that your customer is having trouble with these products. As for ab66253, we haven't tested this antibody in endogenous samples, so we are unsure how it will work with brain tissue.  However, we have...

Read More

I am very pleased to hear you would like to accept our offer and test ab66253 and ab53521 in IHC-P. This code will give you 1 free primary antibody before the expiration date. To redeem this offer, please submit an Abreview for IHC-P and include this c...

Read More
Application Immunohistochemistry (Frozen sections)
Sample Human Tissue sections (Control (normal) - Pons)
Specification Control (normal) - Pons
Fixative Acetone
Permeabilization No
Blocking step Milk as blocking agent for 30 minute(s) · Concentration: 10% · Temperature: 20°C
Username

Abcam user community

Verified customer

Submitted Jan 15 2010

Application Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample Human Tissue sections (Control (normal) Brain - Frontal cortex)
Specification Control (normal) Brain - Frontal cortex
Fixative Formaldehyde
Antigen retrieval step Heat mediated - Buffer/Enzyme Used: Citrate buffer (pH 6.0)
Permeabilization No
Blocking step Milk as blocking agent for 30 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 20°C
Username

Abcam user community

Verified customer

Submitted Dec 15 2009

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"