You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Anti-MOBP antibody (ab66253)

Abreviews (2)Q&A (6)

Overview

  • Product nameAnti-MOBP antibodySee all MOBP primary antibodies ...
  • Description
    Mouse monoclonal to MOBP
  • Tested applicationsWB, ELISA more details
  • Species reactivity
    Reacts with: Recombinant Fragment
    Predicted to work with: Human
  • Immunogen

    Recombinant full length protein (Human, AAH22471, 1 a.a. ~ 82 a.a) with tag. MW of the tag alone is 26 kDa. MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIV DRKYSICKSGCFYQKKEEDWICCACQKTRLKRKIRPTPKK K

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive controlFull length recombinant MOBP with tag.

Properties

Applications

Our Abpromise guarantee covers the use of ab66253 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB WB: 1/500 - 1/1000. Predicted molecular weight: 21 kDa. This antibody has only been tested in WB against the recombinant protein used as immunogen. We have no data on the detection of endogenous protein.
ELISA ELISA: Use at an assay dependent dilution.

Target

  • RelevanceMOBP (Myelin-associated oligodendrocytic basic protein) is abundantly expressed specifically in oligodendrocytes and is the third most abundant protein in CNS myelin. MOBP is present in the major dense line of CNS myelin suggesting a role in the compaction or stabilization of myelin.
  • Cellular localizationCytoplasmic
  • Database links
    • Alternative names
        MGC87379 antibodyMyelin associated oligodendrocyte basic protein antibody

    Anti-MOBP antibody images

    • Western blot - MOBP antibody (ab66253)
      Western blot - MOBP antibody (ab66253)


      Predicted band size : 21 kDa

    References for Anti-MOBP antibody (ab66253)

    ab66253 has not yet been referenced specifically in any publications.

    Publishing research using ab66253 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab66253 Submit a Question for ab66253

    Displaying 1 - 8 of 8 results for Abreviews and Q&A

    10
    Votes: Highest First

    We use homogenized human brain tissue to isolate the protein.  We run the protein on 4-20% gels. We used PVDF membrane for the transfer.  We use licor-odyssey blocking buffer as our blocking agent for 1 hour at room temperature.  We used a concentration o...

    Read More

    Thank you very much for sending this information. I am sorry that these antibodies did not work as expected. I have issued the credits to Cedarlane, and I will contact them to pass these credits on to you. Please let me know if you have an...

    Read More

    Attached are Images from the antibodies on Human samples.  

    Thanks so much for forwarding the images. I am sorry to see that the results were so poor. Could you also send the general protocol that was used? As mentioned previously, I can send replacements or issue credit or refunds for the integrin beta 1 ...

    Read More

    Thanks for the quick reply. There were no bands with those antibodies which is something that we rarely find. We ran the blots with other antibodies (psd95) and got the typical bands.   

    Thanks for your reply and for clarifying that, and I look forward to receiving any data or images that you can provide. Please let me know if you need anything else from me.

    We ordered 3 antibodies.  They were MOBP AB66253, Integrin beta 1 AB7168 and Integrin beta 3 AB110131. We used western blot on Human protein samples, Rat protein samples, rabbit protein samples and cat protein samples. We did not see any bands in either h...

    Read More

    Thank you very much for your replies and for sending the information. I am sorry to hear that none of these antibodies gave the expected results. Just to clarify, there were no bands in Western blot even with the human protein samples? We do guarantee the...

    Read More

    I had a customer contact me regarding some problems she had with three antibodies ordered on PO 134004. I have attached her protocol information and images. She had also ordered AB62631 at the same time, and this antibody worked well for her.

    Thank you for your inquiry and I'm sorry to hear that your customer is having trouble with these products. As for ab66253, we haven't tested this antibody in endogenous samples, so we are unsure how it will work with brain tissue.  However, we have te...

    Read More

    I would like to test ab66253 and ab53521 in IHC-P, an untested application.

    I am very pleased to hear you would like to accept our offer and test ab66253 and ab53521 in IHC-P. This code will give you 1 free primary antibody before the expiration date. To redeem this offer, please submit an Abreview for IHC-P and include this code...

    Read More

    Immunohistochemistry (Frozen sections) abreview for Anti-MOBP antibody

     Average
    Abreviews
    Application Immunohistochemistry (Frozen sections)
    Sample Human Tissue sections (Control (normal) - Pons)
    Specification Control (normal) - Pons
    Fixative Acetone
    Permeabilization No
    Blocking step Milk as blocking agent for 30 minute(s) · Concentration: 10% · Temperature: 20°C
    Read More
    abreview image
    Username

    Verified customer

    Submitted Jan 15 2010

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) abreview for Anti-MOBP antibody

     Average
    Abreviews
    Application Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
    Sample Human Tissue sections (Control (normal) Brain - Frontal cortex)
    Specification Control (normal) Brain - Frontal cortex
    Fixative Formaldehyde
    Antigen retrieval step Heat mediated - Buffer/Enzyme Used: Citrate buffer (pH 6.0)
    Permeabilization No
    Blocking step Milk as blocking agent for 30 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 20°C
    Read More
    abreview image
    Username

    Verified customer

    Submitted Dec 15 2009

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"