Overview
- Product nameAnti-Manic Fringe antibodySee all Manic Fringe primary antibodies ...
- DescriptionRabbit polyclonal to Manic Fringe
- Tested applicationsWB more details
- Species reactivityReacts with: Human
Predicted to work with: Mouse, Rat, Dog, Chimpanzee - Immunogen
Synthetic peptide corresponding to a region within amino acids 211-260 (MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQP SPLFHSHLETL) of Human Manic Fringe (NP_002396).
- Positive controlHepG2 cell lysate
Properties
- FormLiquid
- Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
- Storage bufferPreservative: None
Constituents: 2% Sucrose, PBS -
Concentration information loading... - PurityImmunogen affinity purified
- Clonality Polyclonal
- IsotypeIgG
- Research Areas
Applications
Our Abpromise guarantee covers the use of ab104708 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Notes |
|---|---|
| WB | WB: Use a concentration of 0.25 µg/ml. Predicted molecular weight: 36 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T. |
Target
- FunctionGlycosyltransferase involved in the elongation of O-linked ligands to activate Notch signaling. Possesses fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity.
- Sequence similaritiesBelongs to the glycosyltransferase 31 family.
- Cellular localizationGolgi apparatus membrane.
-
Database links
- Entrez Gene: 458811 Chimpanzee
- Entrez Gene: 4242 Human
- Entrez Gene: 4242 Human
- Entrez Gene: 4242 Human
- Entrez Gene: 17305 Mouse
- Entrez Gene: 315119 Rat
- Omim: 602577 Human
- SwissProt: Q5IS64 Chimpanzee
- SwissProt: O00587 Human
- SwissProt: O00587 Human
- SwissProt: O00587 Human
- SwissProt: O09008 Mouse
- SwissProt: Q6P776 Rat
- Unigene: 6369 Chimpanzee
- Unigene: 517603 Human
- Unigene: 149235 Mouse
- Unigene: 102109 Rat
see all
Target information above from: UniProt accession
O00587
The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010)
.
-
Alternative names
- 3-N-acetylglucosaminyltransferase manic fringe antibodyBeta-1 antibodyBeta-1,3-N-acetylglucosaminyltransferase manic fringe antibody
- MFNG antibodyMFNG_HUMAN antibodyO-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase antibody
see all
Anti-Manic Fringe antibody images
-
Western blot - Manic Fringe antibody (ab104708)Anti-Manic Fringe antibody (ab104708) at 1/0.25 dilution + HepG2 cell lysate at 10 µg
Predicted band size : 36 kDa
References for Anti-Manic Fringe antibody (ab104708)
ab104708 has not yet been referenced specifically in any publications.
