You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Mannose 6 Phosphate Receptor (Cation independent) protein (Tagged-His Tag) (ab92245)

Submit an Abreview Submit a Question

Overview

  • Product nameMannose 6 Phosphate Receptor (Cation independent) protein (Tagged-His Tag)See all Mannose 6 Phosphate Receptor (Cation independent) proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 1510-1761 of Human Mannose 6 Phosphate Receptor (Cation independent) with N terminal His tag; 252 amino acids, 29kDa (27.2kDa predicted from sequence). UniProt ID = P11717.
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 81 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Sequence notesSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVY MSICGENENCPPGVGACFGQ TRISVGKANKRLRYVDQV LQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLI SL DKQTCTLFFSWHTPLACEQATECSVRNGSSIVDLSP LIHRTGGYEAYDESEDDASDTNPD FYINICQPLNPMHG VPCPAGAAVCKVPIDGPPIDIGRVAGPPILNPIANEIYLN FESSTP CLADKHFNYTSL
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab92245 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
  • Application notesSDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        300 kDa mannose 6 phosphate receptor300 kDa mannose 6-phosphate receptorCation independent mannose 6 phosphate receptor
        Cation-independent mannose-6-phosphate receptorCD222CD222 antigenCI Man 6 P receptorCI Man-6-P receptorCI MPRCI-MPRCIMPRIGF 2 receptorIGF 2RIGF II receptorIGF-II receptorIGF2 receptorIGF2RInsulin like growth factor 2 receptorInsulin like growth factor II receptorInsulin-like growth factor 2 receptorInsulin-like growth factor II receptorM6P RM6P/IGF2 receptorM6P/IGF2RM6PRMPR 300MPR300MPRIMPRI_HUMAN
      see all
  • FunctionTransport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex. This receptor also binds IGF2. Acts as a positive regulator of T-cell coactivation, by binding DPP4.
  • Sequence similaritiesBelongs to the MRL1/IGF2R family.
    Contains 1 fibronectin type-II domain.
  • DomainContains 15 repeating units of approximately 147 AA. The most highly conserved region within the repeat consists of a stretch of 13 AA that contains cysteines at both ends.
  • Cellular localizationLysosome membrane. Colocalized with DPP4 in internalized cytoplasmic vesicles adjacent to the cell surface.

    • Target information above from: UniProt accession P11717 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    Mannose 6 Phosphate Receptor (Cation independent) protein (Tagged-His Tag) images

    • SDS-PAGE - Mannose 6 Phosphate Receptor (Cation independent) protein (Tagged-His Tag) (ab92245)
      SDS-PAGE - Mannose 6 Phosphate Receptor (Cation independent) protein (Tagged-His Tag) (ab92245)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for Mannose 6 Phosphate Receptor (Cation independent) protein (Tagged-His Tag) (ab92245)

    ab92245 has not yet been referenced specifically in any publications.

    Publishing research using ab92245 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab92245 Submit a Question for ab92245

    There are currently no Abreviews or Questions for ab92245.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"