Anti-Mov10 antibody [15C1B8] (ab176687)
Key features and details
- Mouse monoclonal [15C1B8] to Mov10
- Suitable for: WB, IP, IHC-Fr
- Reacts with: Mouse, Human
- Isotype: IgG1
Overview
-
Product name
Anti-Mov10 antibody [15C1B8]
See all Mov10 primary antibodies -
Description
Mouse monoclonal [15C1B8] to Mov10 -
Host species
Mouse -
Tested applications
Suitable for: WB, IP, IHC-Frmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Cow, Dog, Chimpanzee, Rhesus monkey, Gorilla, Orangutan -
Immunogen
Synthetic peptide within Human Mov10 aa 953-1003. The exact sequence is proprietary. NP_066014.1.
Sequence:LDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWRNE L
Database link: Q9HCE1 -
Positive control
- WB: NIH3T3, 293T, HeLa and Jurkat lysate. IHC-Fr: Human testicular seminoma tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 99% Tris buffered saline, 0.1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Monoclonal -
Clone number
15C1B8 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176687 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/1000 - 1/10000. Predicted molecular weight: 114 kDa.
|
|
IP |
Use at 2-5 µg/mg of lysate.
|
|
IHC-Fr |
1/20 - 1/80.
Epitope retrieval with citrate buffer pH 6.0 is recommended for FFPE tissue sections. |
Notes |
---|
WB
1/1000 - 1/10000. Predicted molecular weight: 114 kDa. |
IP
Use at 2-5 µg/mg of lysate. |
IHC-Fr
1/20 - 1/80. Epitope retrieval with citrate buffer pH 6.0 is recommended for FFPE tissue sections. |
Target
-
Relevance
MOV10 may be an helicase with an important function in development and/or control of cell proliferation. RNA silencing processes are guided by small RNAs known as siRNAs and microRNAs (miRNAs). They reside in ribonucleoprotein complexes, which guide the cleavage of complementary mRNAs or affect stability and translation of partial complementary mRNAs. Argonaute (Ago) proteins are at the heart of silencing effector complexes and bind the single-stranded siRNA and miRNA. Ago1- and Ago2-containing complexes have been purified from human cells, resulting in the discovery of novel factors such as the putative RNA helicase MOV10, and the RNA recognition motif (RRM)-containing protein TNRC6B/KIAA1093. The new proteins localize, similar to Ago proteins, to mRNA-degrading cytoplasmic P bodies, and they are functionally required to mediate miRNA-guided mRNA cleavage. -
Cellular localization
Cytoplasmic -
Database links
- Entrez Gene: 457099 Chimpanzee
- Entrez Gene: 523206 Cow
- Entrez Gene: 483219 Dog
- Entrez Gene: 101128877 Gorilla
- Entrez Gene: 4343 Human
- Entrez Gene: 17454 Mouse
- Entrez Gene: 100458347 Orangutan
- Omim: 610742 Human
see all -
Alternative names
- DKFZp667O1423 antibody
- FLJ32791 antibody
- fSAP113 antibody
see all
Images
-
All lanes : Anti-Mov10 antibody [15C1B8] (ab176687) at 0.1 µg/ml
Lane 1 : Mouse NIH-3T3 lysate at 50 µg
Lane 2 : Mouse NIH-3T3 lysate at 15 µg
Lane 3 : 293T lysate at 50 µg
Lane 4 : HeLa lysate at 50 µg
Lane 5 : Jurkat lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 114 kDa
Exposure time: 3 minutes -
Immunohistochemical analysis of frozen sections of Human testicular seminoma tissue labeling Mov10 with ab176687 at a 1/1000 dilution. DAB staining.
-
Detection of Human Mov10 by Western Blot of Immunoprecipitates. 1 mg for IP; 20% of IP Mouse NIH3T3 whole cell lysate loaded. ab176687 used for IP at 6 µg/mg lysate. For blotting immunoprecipitated Mov10, ab176687 was used at 1 µg/ml.
Protocols
Datasheets and documents
-
Datasheet download
References (3)
ab176687 has been referenced in 3 publications.
- Haikerwal A et al. Inhibition of Venezuelan Equine Encephalitis Virus Using Small Interfering RNAs. Viruses 14:N/A (2022). PubMed: 35893693
- Puray-Chavez MN et al. Effects of Moloney Leukemia Virus 10 Protein on Hepatitis B Virus Infection and Viral Replication. Viruses 11:N/A (2019). PubMed: 31319455
- Rajgor D et al. NMDAR-dependent Argonaute 2 phosphorylation regulates miRNA activity and dendritic spine plasticity. EMBO J 37:N/A (2018). PubMed: 29712715