Anti-N acetylglucosamine kinase antibody (ab203900)

Overview

  • Product name
    Anti-N acetylglucosamine kinase antibody
    See all N acetylglucosamine kinase primary antibodies
  • Description
    Rabbit Polyclonal to N acetylglucosamine kinase
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human N acetylglucosamine kinase aa 15-100.
    Sequence:

    SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDP LVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSE


    Database link: Q9UJ70

  • Positive control
    • Human lymph node tissue. RT4 and U-251 MG cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab203900 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 37 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • All lanes : Anti-N acetylglucosamine kinase antibody (ab203900) at 1/100 dilution

    Lane 1 : Molecular marker
    Lane 2 : RT4 cell lysate
    Lane 3 : U-251 MG cell lysate


    Predicted band size : 37 kDa
  • Immunohistochemical analysis of Human lymph node tissue labeling N acetylglucosamine kinase with ab203900 at 1/200 dilution.

References

ab203900 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203900.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up