Overview

  • Product name
    Anti-N myc interactor antibody
    See all N myc interactor primary antibodies
  • Description
    Rabbit polyclonal to N myc interactor
  • Tested applications
    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human N myc interactor aa 62-202.
    Sequence:

    EDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEK EEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINV TEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGS


    Database link: Q13287

  • Positive control
    • WB: Rat heart lysate. IHC-P: Human colon cancer tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224675 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 36 kDa (predicted molecular weight: 35 kDa).

Target

  • Relevance
    NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT mediated transcription in response to cytokines IL2 and IFN gamma. The NMI mRNA has high expression in myeloid leukemia cell lines.
  • Cellular localization
    Cytoplasmic
  • Database links
  • Alternative names
    • N myc (and STAT) interactor antibody
    • N myc and STAT interactor antibody
    • N myc interactor antibody
    • NMI antibody
    • NMYC and STAT interactor antibody
    • NMYC interactor antibody
    see all

Images

  • Anti-N myc interactor antibody (ab224675) at 1/500 dilution + Rat heart lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size : 35 kDa
    Observed band size : 36 kDa (why is the actual band size different from the predicted?)
  • Paraffin-embedded human colon cancer tissue stained for N myc interactor using ab224675 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for N myc interactor (green) using ab224675 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab224675 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224675.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up