
  • Product nameAnti-NIT1 antibodySee all NIT1 primary antibodies ...
  • Description
    Rabbit polyclonal to NIT1
  • Tested applicationsWB more details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 71-120 (VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLARE C) of Human NIT1 (NP_005591).

  • Positive control
    • 293T cell lysate.



Our Abpromise guarantee covers the use of ab98066 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 36 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionPlay a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. Has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tumor suppressor activity of FHIT. it is also a negative regulator of primary T-cells. Has apparently no omega-amidase activity such as NIT2.
  • Tissue specificityDetected in heart, brain, placenta, liver, skeletal muscle, kidney and pancreas.
  • Sequence similaritiesBelongs to the UPF0012 family.
    Contains 1 CN hydrolase domain.
  • Cellular localizationCytoplasm. Mitochondrion.
  • Target information above from: UniProt accession Q86X76 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links
  • Alternative names
    • MGC57670 antibody
    • NIT1 antibody
    • NIT1_HUMAN antibody
    • Nitrilase 1 antibody
    • Nitrilase homolog 1 antibody
    see all

Anti-NIT1 antibody images

  • Anti-NIT1 antibody (ab98066) at 1 µg/ml (in 5% skim milk / PBS buffer) + 293T Cell Lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 36 kDa

References for Anti-NIT1 antibody (ab98066)

ab98066 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98066.
Please use the links above to contact us or submit feedback about this product.