Anti-NME4 antibody (ab98198)

Overview

• Product nameAnti-NME4 antibodySee all NME4 primary antibodies ...
• Description
  Rabbit polyclonal to NME4
• Tested applicationsWB more details
• Species reactivity
  Reacts with: Human
  
• Immunogen

  Synthetic peptide corresponding to internal sequence amino acids 107-156 (VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHI SRNVIHASDSV) of Human NME4 (NP 005000)

  Run BLAST with Run BLAST with
• Positive controlHuman fetal heart lysate

Properties

• FormLiquid
• Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
• Storage bufferPreservative: None
  Constituents: 2% Sucrose, PBS
• Concentration information loading...
• PurityImmunogen affinity purified
• Clonality Polyclonal
• IsotypeIgG
• Research Areas
  • Metabolism
  • Types of disease
  • Cancer

  • Metabolism
  • Pathways and Processes
  • Mitochondrial Metabolism
  • Mitochondrial markers

  • Metabolism
  • Pathways and Processes
  • Metabolic signaling pathways
  • Energy transfer pathways
  • Energy Metabolism

  • Signal Transduction
  • Metabolism
  • Energy Metabolism

  • Signal Transduction
  • Second Messenger
  • Nucleotide Messenger
  • GTP

  • Neuroscience
  • Neurology process
  • Neurogenesis

Applications

Target

• FunctionMajor role in the synthesis of nucleoside triphosphates other than ATP.
• Tissue specificityWidely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes.
• Sequence similaritiesBelongs to the NDK family.
• Cellular localizationMitochondrion intermembrane space.

Target information above from: UniProt accession O00746 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt
• Database links
  • Entrez Gene: 4833 Human
  • Omim: 601818 Human
  • SwissProt: O00746 Human
  • Unigene: 9235 Human

• Alternative names
  mitochondrial antibodyNDK antibodyNDKM_HUMAN antibody

  NDP kinase antibodyNDP kinase, mitochondrial antibodyNDPKD antibodynm23 H4 antibodynm23-H4 antibodyNM23D antibodyNm23M4 antibodyNME4 antibodyNon metastatic cells 4 protein expressed in antibodyNucleoside diphosphate kinase D antibodyNucleoside diphosphate kinase, mitochondrial antibody

  see all

Anti-NME4 antibody images

• 

  Western blot - NME4 antibody (ab98198)
  Anti-NME4 antibody (ab98198) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal heart lysate at 10 µg
  
  Secondary
  HRP conjugated anti-Rabbit IgG at 1/50000 dilution
  
  Predicted band size : 21 kDa