You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameNORE1 protein (Tagged-His Tag)See all NORE1 proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 35-260 (226 amino acids) of Human NORE1 Isoform 2 with an N terminal His tag; MWt 26 kDa (UniProt Q8WWW0-2).
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 123 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Sequence notesSKHLSKNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLG MKLSEDGT YTGFIKVHLKLRRPVTVPAGIRPQSIYDAI KEVNLAATTDKRTSFYLP LDAIKQLHISSTTTVSEVIQ GLLKKFMVVDNPQKFALFKRIHKDGQVL FQKLSIADRP LYLRLLAGPDTEVLSFVLKENETGEVEWDAFSIPELQN FLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab91842 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
  • Application notesSDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        Maxp 1MAXP1MGC10823
        MGC17344New ras effector 1NORE 1NORE1ANORE1BNovel Ras effector 1RAP1 Binding ProteinRAPLRas association (RalGDS/AF 6) domain family 5Ras association (RalGDS/AF 6) domain family member 5Ras association domain containing family protein 5Ras association domain-containing protein 5Ras effector like proteinRASF5_HUMANRASSF 3RASSF 5RASSF3RASSF5Regulator for cell adhesion and polarization enriched in lymphoid tissueRegulator for cell adhesion and polarization enriched in lymphoid tissuesTumor suppressor RASSF3
      see all
  • FunctionPotential tumor suppressor. Seems to be involved in lymphocyte adhesion by linking RAP1A activation upon T cell receptor or chemokine stimulation to integrin activation. Isoform 2 stimulates lymphocyte polarization and the patch-like distribution of ITGAL/LFA-1, resulting in an enhanced adhesion to ICAM1. Together with RAP1A may participate in regulation of microtubule growth. The association of isoform 2 with activated RAP1A is required for directional movement of endothelial cells during wound healing. May be involved in regulation of Ras apoptotic function. The RASSF5-STK4 complex may mediate HRAS1 and KRAS induced apoptosis.
  • Tissue specificityWidely expressed. Frequently down-regulated in lung tumor cell lines and primary lung tumors.
  • Sequence similaritiesContains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 Ras-associating domain.
    Contains 1 SARAH domain.
  • Cellular localizationCytoplasm. Cytoplasm > cytoskeleton. Isoform 2 is mainly located in the perinuclear region of unstimulated primary T cells. Upon stimulation translocates to the leading edge and colocalizes with ITGAL/LFA-1 in the peripheral zone of the immunological synapse. Isoform 2 is localized to growing microtubules in vascular endothelial cells and is dissociated from microtubules by activated RAP1A.

    • Target information above from: UniProt accession Q8WWW0 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    NORE1 protein (Tagged-His Tag) images

    • SDS-PAGE - NORE1 protein (Tagged-His Tag) (ab91842)
      SDS-PAGE - NORE1 protein (Tagged-His Tag) (ab91842)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images colored control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for NORE1 protein (Tagged-His Tag) (ab91842)

    ab91842 has not yet been referenced specifically in any publications.

    Publishing research using ab91842 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab91842 Submit a Question for ab91842

    There are currently no Abreviews or Questions for ab91842.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"