Loading...
If your product does not perform as described on this datasheet, we will refund or replace your product...
Read our guarantee »Products:Neuroscience >> Endocrine system >> Gonadotrophic axis
Anti-NR0B1 / Dax1 antibody
See all NR0B1 / Dax1 products (11) ...
Mouse polyclonal to NR0B1 / Dax1
Reacts with
Mouse
Fusion protein: SLLTSAQQTHVSREAPEAHRRGEWWQLSYCTQSVGGPEGL QSTQAMAFLYRSYVCGEEQPQQISVASGTPVSADQTPATP QEQPRAPWWDASPGVQRLIT, corresponding to amino acids 150/249 of Mouse NR0B1.
SLLTSAQQTH VSREAPEAHR RGEWWQLSYC TQSVGGPEGL QSTQAMAFLY RSYVCGEEQP QQISVASGTP VSADQTPATP QEQPRAPWWD ASPGVQRLIT
Liquid
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
Constituents: 50% Glycerol
Whole antiserum
This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al.PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
Polyclonal
IgG
Developmental Biology >> Reproduction >> Placental development
Developmental Biology >> Reproduction >> Sex determination
Epigenetics and Nuclear Signaling >> Nuclear Signaling Pathways >> Nuclear Receptors >> Orphan Nuclear Receptors
Epigenetics and Nuclear Signaling >> Nuclear Signaling Pathways >> Nuclear Receptors >> Retinoic & Retinoid
Neuroscience >> Endocrine system >> Hypothalamic pituitary adrenal axis
Neuroscience >> Endocrine system >> Gonadotrophic axis
Western blot - NR0B1 antibody (ab21884)
(enlarge)
Our Abpromise guarantee covers the use of ab21884 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
WB: 1/1000. Predicted molecular weight: 52 kDa.
Not tested in other applications.
Optimal dilutions/concentrations should be determined by the end user.
This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.
Orphan nuclear receptor. Component of a cascade required for the development of the hypothalamic-pituitary-adrenal-gonadal axis. Acts as a coregulatory protein that inhibits the transcriptional activity of other nuclear receptors through heterodimeric interactions. May also have a role in the development of the embryo and in the maintenance of embryonic stem cell pluripotency.
Defects in NR0B1 are the cause of X-linked adrenal hypoplasia congenital (XL-AHC) [MIM:300200]; also known as X-linked Addison disease (AHX). XL-AHC is a developmental disorder of the adrenal gland that results in profound hormonal deficiencies and is lethal if untreated. It is characterized by the absence of the permanent zone of the adrenal cortex and by a structural disorganization of the glands. Hypogonadotropic hypogonadism (HHG) is frequently associated with this disorder. HHG is a condition resulting from or characterized by abnormally decreased gonadal function, with retardation of growth and sexual development.
Defects in NR0B1 are the cause of 46,XY sex reversal type 2 (SRXY2) [MIM:300018]. It is a condition characterized by male-to-female sex reversal in the presence of a normal 46,XY karyotype. Note=XY individuals with a duplication of part of the short arm of the X chromosome and an intact SRY gene develop as females. The single X chromosome in these individuals does not undergo X-chromosome inactivation; therefore, these individuals presumably carry 2 active copies of genes, including the NR0B1 gene, in the duplicated region. Individuals with deletion of this region develop as males. Genes within the dosage-sensitive sex reversal region are, therefore, not essential for testis development, but, when present in a double dose, interfere with testis formation.
Belongs to the nuclear hormone receptor family. NR0 subfamily.
Homodimerization involved an interaction between amino and carboxy termini involving LXXLL motifs and steroid binding domain (AF-2 motif). Heterodimerizes with NR5A1 and NROB2 through its N-terminal LXXLL motifs.
Nucleus. Cytoplasm. Shuttles between the cytoplasm and nucleus. Homodimers exits in the cytoplasm and in the nucleus.
Target information above from: UniProt accessionP51843
The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010).
Western blot - NR0B1 antibody (ab21884)

All lanes : Anti-NR0B1 / Dax1 antibody (ab21884) at 1/1000 dilution
Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a
negative control fusion protein with an irrelevant antigen at 20 ug
Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the
antigen fusion protein at 20 ug
Secondary
Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at
1/5000 dilution
Predicted band size : 52 kDa
The molecular weight of the band on the western blot does not correspond to the predicted band size above (predicted from the molecular weight of the natural protein) because of the additional mass of the fusion and because the fusion protein only contains a partial fragment of the gene.
ab21884 has not yet been referenced specifically in any publications.
Publishing research using ab21884? Please let us know so that we can cite the reference in this datasheet
Concentration of lot no. is
Concentration not available for this lot.
Find concentration of your lot:

All lanes : Anti-NR0B1 / Dax1 antibody (ab21884) at 1/1000 dilution
Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a
negative control fusion protein with an irrelevant antigen at 20 ug
Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the
antigen fusion protein at 20 ug
Secondary
Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at
1/5000 dilution
Predicted band size : 52 kDa
The molecular weight of the band on the western blot does not correspond to the predicted band size above (predicted from the molecular weight of the natural protein) because of the additional mass of the fusion and because the fusion protein only contains a partial fragment of the gene.
0
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
Call 01223 696 000 or contact us
