You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameNoggin protein (Active)See all Noggin proteins and peptides ...
  • Protein descriptionRecombinant full length human Noggin protein; consisting of two 206 amino acid polypeptide chains, 46.2 kDa (each chain 23.1 kDa). Swiss ID = Q13253.
  • Expression hostE. coli

    • Properties

  • Purity> 95 % by SDS-PAGE
  • Purification notesab73756 is purified by proprietary chromatographic techniques and 0.2µm filtered.
  • FormLyophilised:It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Further dilutions should be made in appropriate buffered solutions.
  • Storage instructionsAliquot and store at -80°C. Avoid repeated freeze / thaw cycles.This product is an active protein and may elicit a biological response in vivo, handle with caution.
  • Storage bufferPreservative: None
    Constituents: 0.1% Trifluoroacetic acid
  • Concentration information loading...
  • Additional notesFor long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Sequence notesMQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLL RSLLGGHYDPGFMATS PPEDRPGGGGGAAGGAEDLAEL DQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLS KKLR RKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKR SCSVPEGMVCKP SKSVHLTVLRWRCQRRGQRCGWIPIQ YPIISECKCSC
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab73756 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE SDS-PAGE: Use at an assay dependent dilution.
    Functional Studies FuncS: Use at an assay dependent dilution. Biological Activity: The ED50 was determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 0.05-0.08 µg/ml of Noggin.
    WB WB: Use at an assay dependent concentration. Ab73756 can be used as a WB positive control in conjunction with ab16054.
  • Application notesThis peptide can be used with studies using ab16054.

    • Protein info

    • Alternative names
        NOGNOGG_HUMANNoggin
        SYM 1SYM1Symphalangism 1 (proximal)Synostoses (multiple) syndrome 1SYNS 1SYNS1
      see all
  • FunctionEssential for cartilage morphogenesis and joint formation. Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite.
  • Involvement in diseaseDefects in NOG are a cause of symphalangism proximal syndrome (SYM1) [MIM:185800]. SYM1 is characterized by the hereditary absence of the proximal interphalangeal (PIP) joints (Cushing symphalangism). Severity of PIP joint involvement diminishes towards the radial side. Distal interphalangeal joints are less frequently involved and metacarpophalangeal joints are rarely affected whereas carpal bone malformation and fusion are common. In the lower extremities, tarsal bone coalition is common. Conducive hearing loss is seen and is due to fusion of the stapes to the petrous part of the temporal bone.
    Defects in NOG are the cause of multiple synostoses syndrome type 1 (SYNS1) [MIM:186500]; also known as synostoses, multiple, with brachydactyly/symphalangism-brachydactyly syndrome. SYNS1 is characterized by tubular-shaped (hemicylindrical) nose with lack of alar flare, otosclerotic deafness, and multiple progressive joint fusions commencing in the hand. The joint fusions are progressive, commencing in the fifth proximal interphalangeal joint in early childhood (or at birth in some individuals) and progressing in an ulnar-to-radial and proximal-to-distal direction. With increasing age, ankylosis of other joints, including the cervical vertebrae, hips, and humeroradial joints, develop.
    Defects in NOG are the cause of tarsal-carpal coalition syndrome (TCC) [MIM:186570]. TCC is an autosomal dominant disorder characterized by fusion of the carpals, tarsals and phalanges, short first metacarpals causing brachydactyly, and humeroradial fusion. TCC is allelic to SYM1, and different mutations in NOG can result in either TCC or SYM1 in different families.
    Defects in NOG are a cause of stapes ankylosis with broad thumb and toes (SABTS) [MIM:184460]; also known as Teunissen-Cremers syndrome. SABTS is a congenital autosomal dominant disorder that includes hyperopia, a hemicylindrical nose, broad thumbs, great toes, and other minor skeletal anomalies but lacked carpal and tarsal fusion and symphalangism.
    Defects in NOG are the cause of brachydactyly type B2 (BDB2) [MIM:611377]. BDB2 is a subtype of brachydactyly characterized by hypoplasia/aplasia of distal phalanges in combination with distal symphalangism, fusion of carpal/tarsal bones, and partial cutaneous syndactyly.
  • Sequence similaritiesBelongs to the noggin family.
  • Cellular localizationSecreted.

    • Target information above from: UniProt accession Q13253 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    Noggin protein (Active) images

    • Western blot - Anti-Noggin antibody (ab16054)
      Western blot - Anti-Noggin antibody (ab16054)
      Anti-Noggin antibody (ab16054) at 1 µg/ml + Noggin protein (Active) (ab73756) at 1 µg

      Secondary
      Goat polyclonal Secondary Antibody to Rabbit IgG - H&L (HRP), pre-adsorbed (ab97080) at 1/5000 dilution
      developed using the ECL technique

      Performed under reducing conditions.

      Exposure time : 4 minutes

    References for Noggin protein (Active) (ab73756)

    ab73756 has not yet been referenced specifically in any publications.

    Publishing research using ab73756 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab73756 Submit a Question for ab73756

    There are currently no Abreviews or Questions for ab73756.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"