You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameOTUB1 protein (Tagged-His Tag)See all OTUB1 proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 1-165 (165 amino acids) of Human OTUB1 with an N terminal His tag. Predicted MWt: 20 kDa; UniProt ID = Q96FW1.
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 125 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Sequence notesMAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQE IAVQNPLVSERLEL SVLYKEYAEDDNIYQQKIKDLHKK YSYIRKTRPDGNCFYRAFGFSHLEALLDDS KELQRFKA VSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVA DLLASF NDQ
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab91823 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
    MS
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        Deubiquitinating enzyme OTUB1hOTU1OTB1
        OTU domain containing ubiquitin aldehyde binding protein 1OTU domain-containing ubiquitin aldehyde-binding protein 1OTU1Otub1OTUB1_HUMANOtubain 1Otubain-1Ubiquitin specific processing protease OTUB1Ubiquitin thioesterase OTUB1Ubiquitin-specific-processing protease OTUB1
      see all
  • FunctionHydrolase that can remove conjugated ubiquitin from proteins and plays an important regulatory role at the level of protein turnover by preventing degradation. Regulator of T-cell anergy, a phenomenon that occurs when T-cells are rendered unresponsive to antigen rechallenge and no longer respond to their cognate antigen. Acts via its interaction with RNF128/GRAIL, a crucial inductor of CD4 T-cell anergy. Isoform 1 destabilizes RNF128, leading to prevent anergy. In contrast, isoform 2 stabilizes RNF128 and promotes anergy. Surprisingly, it regulates RNF128-mediated ubiquitination, but does not deubiquitinate polyubiquitinated RNF128. Deubiquitinates estrogen receptor alpha (ESR1). Mediates deubiquitination of 'Lys-48'-linked polyubiquitin chains, but not 'Lys-63'-linked polyubiquitin chains. Not able to cleave di-ubiquitin. Also capable of removing NEDD8 from NEDD8 conjugates, but with a nuch lower preference compared to 'Lys-48'-linked ubiquitin.
  • Tissue specificityIsoform 1 is ubiquitous. Isoform 2 is expressed only in lymphoid tissues such as tonsils, lymph nodes and spleen, as well as peripheral blood mononuclear cells.
  • Sequence similaritiesBelongs to the peptidase C65 family.
    Contains 1 OTU domain.
  • DomainIn addition to ubiquitin-binding at the Cys-91 active site, a proximal ubiquitin-binding site is also present at Cys-23 Occupancy of the active site is needed to enable tight binding to the second site. Distinct binding sites for the ubiquitins may allow to discriminate among different isopeptide linkages (i.e. 'Lys-48'-, 'Lys-63'-linked polyubiquitin) in polyubiquitin substrates and achieve linkage-specific deubiquitination.
  • Cellular localizationCytoplasm.

    • Target information above from: UniProt accession Q96FW1 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    OTUB1 protein (Tagged-His Tag) images

    • SDS-PAGE - OTUB1 protein (Tagged-His Tag) (ab91823)
      SDS-PAGE - OTUB1 protein (Tagged-His Tag) (ab91823)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for OTUB1 protein (Tagged-His Tag) (ab91823)

    ab91823 has not yet been referenced specifically in any publications.

    Publishing research using ab91823 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab91823 Submit a Question for ab91823

    There are currently no Abreviews or Questions for ab91823.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"