You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

P Glycoprotein protein (Tagged-His Tag) (ab92254)

Submit an Abreview Submit a Question

Overview

  • Product nameP Glycoprotein protein (Tagged-His Tag)
  • Protein descriptionRecombinant fragment, corresponding to amino acids 1036-1280 (245 amino acids) of Human P Glycoprotein with N terminal His tag; Predicted MWt 28 kDa (UniProt P08183).
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 37 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Sequence notesTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCG KSTVVQLLE RFYDPLAGKVLLDGKEIKRLNVQWLRAHL GIVSQEPILFDCSIAENIAY GDNSRVVSQEEIVRAAKE ANIHAFIESLPNKYSTKVGDKGTQLSGGQKQ RIAIARA LVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIV IA HRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIY FSMVSVQAGTKRQ
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab92254 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
  • Application notesSDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        ABC20ABCB1ATP binding cassette, sub family B (MDR/TAP), member 1
        ATP-binding cassette sub-family B member 1CD243CLCSColchicin sensitivityDoxorubicin resistanceGP170MDR1MDR1_HUMANMultidrug resistance 1Multidrug resistance protein 1P glycoprotein 1P gpP-glycoprotein 1PGY1
      see all
  • FunctionEnergy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
  • Tissue specificityExpressed in liver, kidney, small intestine and brain.
  • Involvement in diseaseGenetic variations in ABCB1 are associated with susceptibility to inflammatory bowel disease type 13 (IBD13) [MIM:612244]. Inflammatory bowel disease is characterized by a chronic relapsing intestinal inflammation. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may involve any part of the gastrointestinal tract, but most frequently the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints. Crohn disease and ulcerative colitis are commonly classified as autoimmune diseases.
  • Sequence similaritiesBelongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localizationMembrane.

    • Target information above from: UniProt accession P08183 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    P Glycoprotein protein (Tagged-His Tag) images

    • SDS-PAGE - P Glycoprotein protein (Tagged-His Tag) (ab92254)
      SDS-PAGE - P Glycoprotein protein (Tagged-His Tag) (ab92254)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for P Glycoprotein protein (Tagged-His Tag) (ab92254)

    ab92254 has not yet been referenced specifically in any publications.

    Publishing research using ab92254 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab92254 Submit a Question for ab92254

    There are currently no Abreviews or Questions for ab92254.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"