HRP Anti-Papain antibody (ab181737)
Key features and details
- HRP Goat polyclonal to Papain
- Suitable for: WB
- Reacts with: Carica papaya
- Conjugation: HRP
- Isotype: IgG
Overview
-
Product name
HRP Anti-Papain antibody -
Description
HRP Goat polyclonal to Papain -
Host species
Goat -
Conjugation
HRP -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Carica papaya -
Immunogen
Full length native protein (purified) corresponding to Papain aa 133-345. Carica papaya
Sequence:IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSE QELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREK GPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFV GPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVC GLYTSSFYPVKN
Database link: P00784 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
Preservative: 0.01% Gentamicin sulphate
Constituents: 0.27% Potassium phosphate, 0.88% Sodium chloride, 1% BSA
Do not add sodium azide. Immunoglobulin and protease free. -
Concentration information loading...
-
Purity
IgG fraction -
Purification notes
ab181737 is an IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against the buffer stated above. Assay by immunoelectrophoresis resulted in a single precipition arc against anti-Peroxidase anti-Goat Serum as well as purified and partially purified Carica papaya Papain. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Recombinant Protein
-
Related Products
- TMB ELISA Substrate (Highest Sensitivity) (ab171522)
- TMB ELISA Substrate (High Sensitivity) (ab171523)
- TMB ELISA Substrate (Fast Kinetic Rate) (ab171524)
- TMB ELISA Substrate (Slow Kinetic Rate) (ab171525)
- TMB ELISA Substrate (Slower Kinetic Rate) (ab171526)
- TMB ELISA Substrate (Slowest Kinetic Rate) (ab171527)
- 450 nm Stop Solution for TMB Substrate (ab171529)
- 650 nm Stop Solution for TMB Substrate (ab171531)
- Immunoassay Blocking Buffer (ab171534)
- Immunoassay Blocking (BSA Free) (ab171535)
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab181737 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2500. Predicted molecular weight: 39 kDa.
|
Notes |
---|
WB
1/500 - 1/2500. Predicted molecular weight: 39 kDa. |
Target
-
Relevance
Papain is a protease derived from the papaya fruit (Carica papaya). It hydrolyses peptides with broad specificity, but shows a preference for large hydrophobic amino acids in the P2 position. It is synthesised as an inactive 40 kDa precursor containing a 107 residue N terminal pro region and a 26 residue signal peptide. -
Database links
- SwissProt: P00784 Carica papaya
-
Alternative names
- Allergen Car p 1 antibody
- Car p 1 antibody
- Papain antibody
see all
Images
Protocols
Datasheets and documents
-
Datasheet download
References (0)
ab181737 has not yet been referenced specifically in any publications.