Loading...
Products:Neuroscience >> Cell Type Marker >> Neural Stem Cell marker
|
ab111670 |
If your product does not perform as described on this datasheet, we will refund or replace your product...
Read our guarantee »Anti-Pax2 antibody - ChIP Grade
See all Pax2 products (6) ...
Rabbit polyclonal to Pax2 - ChIP Grade
IHC-P, ICC/IF, WB, ChIPmore details
Reacts with
Human
Predicted to work with
Mouse, Rat, Sheep, Zebrafish
A region within synthetic peptide: DPVGSYSING ILGIPRSNGE KRKRDEDVSE GSVPNGDSQS GVDSLRKHLR, corresponding to internal sequence amino acids 180-229 of Human Pax2
DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQS GVDSLRKHLR
IHC-P: Human kidney. ICC: OVCA429 cells (see review) WB: OVCAR-5, OVCAR-3, SKOV3, CaoV3 cell lysates (See review)
Liquid
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Preservative: None
Constituents: 2% Sucrose, PBS
Concentration information loading...
Immunogen affinity purified
Polyclonal
IgG
Developmental Biology >> Organogenesis >> Excretory system development >> Kidney development
Epigenetics and Nuclear Signaling >> ChIP'ing antibodies >> ChIP'ing antibodies
Epigenetics and Nuclear Signaling >> Transcription >> Transcription Factors
Epigenetics and Nuclear Signaling >> Transcription >> Domain Families >> Developmental Families >> PAX
Neuroscience >> Cell Type Marker >> Neural Stem Cell marker
Our Abpromise guarantee covers the use of ab23799 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
IHC-P: Use a concentration of 4 - 8 µg/ml. Perform heat mediated antigen retrieval via the microwave method before commencing with IHC staining protocol.
ICC/IF: 1/250. Fix with 3% paraformaldehyde/2% sucrose (see review by R Drapkin).
WB: Use a concentration of 1 - 2.5 µg/ml. Detects a band of approximately 34 , 41 kDa (predicted molecular weight: 44 , 42 kDa).Dilute antibody in 5% milk in PBS buffer. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ChIP: Use at an assay dependent dilution.
PAX2 is a transcription factor critically required during the development of the nervous and excretory systems, including the midbrain, hindbrain, spinal cord, eye, ear and urogenital tract. Like other products of the PAX gene family, PAX2 encodes a conserved 128 amino acid paired box DNA-binding domain in the N-terminal portion of the molecule.
Nuclear
Western blot - Pax2 antibody (ab23799)

Anti-Pax2 antibody - ChIP Grade (ab23799) at 2.5 µg/ml + Fetal kidney lysate
Predicted band size : 44 , 42 kDa
Observed band size : 34,41 kDa (why is the actual band size different from the predicted?)
Immunohistochemistry (Paraffin-embedded sections) - Pax2 antibody (ab23799)

ab23799, at an antibody concentration of 4.0 - 8.0 µg/ml, staining Human PAX2 in paraffin embeded kidney tissue. The arrows indicate the positively labelled cells, epithelial cells of the renal tube.
Immunocytochemistry/ Immunofluorescence - Pax2 antibody (ab23799)

The human ovarian carcinoma cell line OVCA429 was used with ab23799 in ICC/IF. The cells were fixed in paraformaldehyde. Blocking was in 5% serum for 1 hour. The primary antibody was incubated at a dilution of 1/250 for one hour. Immunofluorescence (ICC/IF) only worked with 3% paraformaldehyde/2% sucrose fixation. When 70% methanol/30% acetone fixation was tried non-specific cytoplasmic staining was seen. In the left hand panel staining with DAPI is shown, and in the right staining with the ab23799 antibody.
This image was taken from an Abreview submitted on January 5, 2006 from Ron Drapkin. We do not have any further information relating to this image.
This product has been referenced in:
See all 4 publications for this product
Publishing research using ab23799? Please let us know so that we can cite the reference in this datasheet
Concentration of lot no. is
Concentration not available for this lot.
Find concentration of your lot:

ab23799, at an antibody concentration of 4.0 - 8.0 µg/ml, staining Human PAX2 in paraffin embeded kidney tissue. The arrows indicate the positively labelled cells, epithelial cells of the renal tube.

The human ovarian carcinoma cell line OVCA429 was used with ab23799 in ICC/IF. The cells were fixed in paraformaldehyde. Blocking was in 5% serum for 1 hour. The primary antibody was incubated at a dilution of 1/250 for one hour. Immunofluorescence (ICC/IF) only worked with 3% paraformaldehyde/2% sucrose fixation. When 70% methanol/30% acetone fixation was tried non-specific cytoplasmic staining was seen. In the left hand panel staining with DAPI is shown, and in the right staining with the ab23799 antibody.
This image was taken from an Abreview submitted on January 5, 2006 from Ron Drapkin. We do not have any further information relating to this image.

4
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
Call 01223 696 000 or contact us
