You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Anti-QK1 antibody (ab78130)

CodeSizePriceAbpointsAvailability
    
 
  • -

  •   
  •   
  •   
  •  

  •  
  •  
  •  

  •  
Updating...

Reassurance, Refunds & Replacements

If your product does not perform as described on this datasheet, we will refund or replace your product...

Read our guarantee »

This product is covered by the Abpromise guarantee. Our scientific support team are available to answer any questions or queries - fill out an inquiry form for ab78130 for help.

Alternatively, you can search the previous enquiries about this product to see if your query has already been answered.

3 questions for ab78130

first page       

Page 1 of 1

     last page  

Question 1

Friday 25-May-2012

Thanks a lot for your kind help...

ANSWER:

 

You are very welcome.



. Please let me know if you have any questions or there are other ways that Abcam may help you meet your research goals.

Question 2

Thursday 24-May-2012

Thank you for your quick reply

ANSWER:

 

Thank you for contacting us.Jeremy is out of the office today, but I’d be happy to help with your inquiry. My name is Keith.

In regards to the immunogen sequence which you have requested. Ab78130 is specific for QK1 isoform 1, known also asHQK-5 or QKI-5. Ab78518 is directed against isoform 4 otherwise known asHQK-7.

Though I have been unable to find the exact immunogen used to create these products, the HQK-7isoform differs from the canonical (HQK-5, sequence as follows:
http://www.uniprot.org/blast/?about=Q96PU8[312-341]: GAVATKVRRHDMRVHPYQRIVTADRAATGN→EWIEMPVMPDISAH Therefore the immunogen specific to this product should be within this region.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Use our products? Submit an Abreview. Earn rewards!
http://www.abcam.com/abreviews

Question 3

Wednesday 23-May-2012

Thank you for your response. I have few other queries as well.
1. My focus of interest is to do both immuno-precipitation and western blotting with Anti-QKI antibody. I would also like to know the difference between the products ab78518 and ab78130 other than ab126742. In all the three you have referred Q96PU8 as the target. Is there a sequence difference among them? If so I would like to know the target sequence of ab78518.
2. Also the concentration of antibody has not been indicated on the website and even in datasheet which I received along with the product. For my work I have to load equal concentration of QKI antibody as well as control antibody. So the concentration is important. It will be useful if you could help me in this aspect also.
3. Since I will be using atleast20ul for each of my reaction, could you please offer me a discount price for bulk quote of 500ul or 1000ul of the antibodies (ab126742 and ab78518).

ANSWER:

 

Thanks for your enquiry.

I have passed your enquiry regarding the immunogen sequence for ab78518 on to the lab. I will forward you any information I receive.

The concentration of these 3 antibodies has not been determined. ab78518 and ab78130is not determined. These are both whole antiserum products and not purified antibodies. However, estimated concentrationof specific primary antibody for whole serum products is about 0.5mg/ml. And ab126742is a tissue culture supernatant product. This is also not a purified antibody and the specific antibody concentration in this sort of productis typically 0.05mg/ml.

Regarding your interest in a bulk order purchase, I recommend contacting our bulk order specialist who can offer you the appropriate discount. Please email your bulk order request to mailto:sales@abcam.com with attention to Andrea Gray.

I hope this is helpful. Please let me know if you have any further questions.

first page       

Page 1 of 1

     last page  

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"