Overview
- Product nameAnti-QPCTL antibodySee all QPCTL primary antibodies ...
- DescriptionRabbit polyclonal to QPCTL
- Tested applicationsWB, ELISA more details
- Species reactivityReacts with: Human
Predicted to work with: Mouse, Rat, Dog - Immunogen
Synthetic peptide derived from within residues: TLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPG PTRIQAIELF, corresponding to amino acids 215-264 of Human QPCTL
- Positive control721_B cell lysate
Properties
- FormLiquid
- Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
- Storage bufferPreservative: None
Constituents: 2% Sucrose, PBS -
Concentration information loading... - PurityImmunogen affinity purified
- Clonality Polyclonal
- IsotypeIgG
- Research Areas
Applications
Our Abpromise guarantee covers the use of ab80847 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Notes |
|---|---|
| WB | |
| ELISA |
WB: Use at a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa.
Not yet tested in other applications.
Optimal dilutions/concentrations should be determined by the end user.
Target
- RelevanceQPCTL belongs to the glutaminyl-peptide cyclotransferase family. There are two named isoforms.
- Cellular localizationMembrane; Single-pass membrane protein
-
Database links
- Entrez Gene: 54814 Human
- Entrez Gene: 54814 Human
- Entrez Gene: 67369 Mouse
- Entrez Gene: 292687 Rat
- SwissProt: Q9NXS2 Human
- SwissProt: Q9NXS2 Human
- SwissProt: Q8BH73 Mouse
- SwissProt: B5DFI7 Rat
-
Alternative names
- Glutaminyl cyclase like antibodyGlutaminyl peptide cyclotransferase like protein antibody
Anti-QPCTL antibody images
-
Anti-QPCTL antibody (ab80847) at 1 µg/ml + 721_B cell lysate at 10 µg
Secondary
HRP conjugated anti-Rabbit IgG at 1/50000 dilution
Predicted band size : 43 kDa
Observed band size : 43 kDa
Additional bands at : 65 kDa. We are unsure as to the identity of these extra bands.
References for Anti-QPCTL antibody (ab80847)
ab80847 has not yet been referenced specifically in any publications.


