
  • Product nameAnti-QPCTL antibodySee all QPCTL primary antibodies ...
  • Description
    Rabbit polyclonal to QPCTL
  • Tested applicationsWB, ELISA more details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cat, Dog
  • Immunogen

    Synthetic peptide derived from within residues: TLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELF , corresponding to amino acids 215-264 of Human QPCTL

  • Positive control
    • 721_B cell lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • Clonality Polyclonal
  • IsotypeIgG
  • Research Areas


Our Abpromise guarantee covers the use of ab80847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay 1/12500.


Anti-QPCTL antibody images

  • Anti-QPCTL antibody (ab80847) at 1 µg/ml + 721_B cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 43 kDa
    Observed band size : 43 kDa
    Additional bands at : 65 kDa. We are unsure as to the identity of these extra bands.

References for Anti-QPCTL antibody (ab80847)

ab80847 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab80847.
Please use the links above to contact us or submit feedback about this product.