Overview

  • Product name
  • Description
    Rabbit polyclonal to RP2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human RP2 aa 183-301.
    Sequence:

    ELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSS DESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFR EKAPDFLPLLNKGPVIALE


    Database link: O75695

  • Positive control
    • RT-4 cell lysate; U-2 OS cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab219976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 40 kDa.

Target

  • Relevance
    Function: Acts as a GTPase-activating protein (GAP) involved in trafficking between the Golgi and the ciliary membrane. Involved in localization of proteins, such as NPHP3, to the cilium membrane by inducing hydrolysis of GTP ARL3, leading to the release of UNC119 (or UNC119B). Acts as a GTPase-activating protein (GAP) for tubulin in concert with tubulin-specific chaperone C, but does not enhance tubulin heterodimerization. Acts as guanine nucleotide dissociation inhibitor towards ADP-ribosylation factor-like proteins. Tissue specificity: Ubiquitous. Expressed in the rod and cone photoreceptors, extending from the tips of the outer segment (OS) through the inner segment (IS) and outer nuclear layer (ONL) and into the synaptic terminals of the outer plexiform layer (ONL). Also detected in the bipolar, horizontal and amacrine cells in the inner nuclear layer (INL), extending to the inner plexiform layer (IPL) and though the ganglion cell layer (GCL) and into the nerve fiber layer (NFL) (at protein level). Disease: Retinitis pigmentosa 2 Similarity: Belongs to the TBCC family. Contains 1 C-CAP/cofactor C-like domain. PTM: Myristoylated on Gly-2; which may be required for membrane targeting. Palmitoylated on Cys-3; which may be required for plasma membrane targeting (Probable). Mutation of Cys-3 targets the protein to internal membranes.
  • Cellular localization
    Cell membrane; Lipid-anchor; Cytoplasmic side
  • Database links
  • Alternative names
    • DELXp11.3 antibody
    • KIAA0215 antibody
    • NM23 H10 antibody
    • NME10 antibody
    • Protein XRP2 antibody
    • Retinitis pigmentosa 2 (X linked recessive) antibody
    • Retinitis pigmentosa 2 antibody
    • RP 2 antibody
    • RP2 antibody
    • RP2 ARL3 GTPase activating protein antibody
    • TBCCD 2 antibody
    • TBCCD2 antibody
    • XRP2 antibody
    • XRP2 protein antibody
    • XRP2_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-251 MG cells labeling RP2 with ab219976 at 4 μg/ml (green).

  • Anti-RP2 antibody (ab219976) at 1/100 dilution + RT-4 cell lysate

    Predicted band size: 40 kDa

References

ab219976 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219976.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up