Anti-RPL6 antibody (ab176705)
Key features and details
- Rabbit polyclonal to RPL6
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-RPL6 antibody
See all RPL6 primary antibodies -
Description
Rabbit polyclonal to RPL6 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig, Non human primates -
Immunogen
Synthetic peptide within Human RPL6 aa 25-75. The exact sequence is proprietary. NP_000961.2.
Sequence:GKVKKGNLKAKKPKKGKPHCSRNPVLVRGIGRYSRSAMYSRKAMYKRKYS A
Database link: Q02878 -
Positive control
- WB: HeLa, 293T and Jurkat whole cell lysate.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176705 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000 - 1/10000. Predicted molecular weight: 33 kDa.
|
Notes |
---|
WB
1/2000 - 1/10000. Predicted molecular weight: 33 kDa. |
Target
-
Function
Specifically binds to domain C of the Tax-responsive enhancer element in the long terminal repeat of HTLV-I. -
Sequence similarities
Belongs to the ribosomal protein L6e family. - Information by UniProt
-
Database links
- Entrez Gene: 511051 Cow
- Entrez Gene: 403691 Dog
- Entrez Gene: 6128 Human
- Entrez Gene: 19988 Mouse
- Entrez Gene: 733592 Pig
- Entrez Gene: 117042 Rat
- Omim: 603703 Human
- SwissProt: Q58DQ3 Cow
see all -
Alternative names
- 60S ribosomal protein L6 antibody
- DNA-binding protein TAXREB107 antibody
- L6 antibody
see all
Images
-
All lanes : Anti-RPL6 antibody (ab176705) at 0.04 µg/ml
Lane 1 : 293T whole cell lysate at 50 µg
Lane 2 : 293T whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 33 kDa
Exposure time: 10 seconds
Datasheets and documents
-
Datasheet download
References (0)
ab176705 has not yet been referenced specifically in any publications.