Anti-RPS14 antibody (ab174661)
Key features and details
- Rabbit polyclonal to RPS14
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-RPS14 antibody
See all RPS14 primary antibodies -
Description
Rabbit polyclonal to RPS14 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Chicken, Turkey, Xenopus laevis, Drosophila melanogaster, Zebrafish, Xenopus tropicalis -
Immunogen
Synthetic peptide within Human RPS14 aa 101-151. The exact sequence is proprietary. NP_001020242.1
Sequence:GGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRR L
Database link: P62263 -
Positive control
- Whole cell lysate from 293T, HeLa, Jurkat, Mouse TCMK-1 and Mouse NIH3T3 cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab174661 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000 - 1/10000.
|
|
IP | (1) |
Use at 2-10 µg/mg of lysate.
|
Notes |
---|
WB
1/2000 - 1/10000. |
IP
Use at 2-10 µg/mg of lysate. |
Target
-
Sequence similarities
Belongs to the ribosomal protein S11P family. - Information by UniProt
-
Database links
- Entrez Gene: 47218 Drosophila melanogaster
- Entrez Gene: 47219 Drosophila melanogaster
- Entrez Gene: 6208 Human
- Entrez Gene: 20044 Mouse
- Entrez Gene: 29284 Rat
- Omim: 130620 Human
- SwissProt: P14130 Drosophila melanogaster
- SwissProt: P62263 Human
see all -
Alternative names
- 40S ribosomal protein S14 antibody
- emetine resistance antibody
- EMTB antibody
see all
Images
-
Detection of RPS14 by Western Blot of Immunoprecipitate.
-
All lanes : Anti-RPS14 antibody (ab174661) at 0.100000001490116 µg/ml
Lane 1 : 293T whole cell lysate
Lane 2 : HeLa whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lane 4 : Mouse TCMK-1 whole cell lysate
Lane 5 : Mouse NIH3T3 whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Exposure time: 3 minutes
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab174661 has been referenced in 2 publications.
- Koppers M et al. Receptor-specific interactome as a hub for rapid cue-induced selective translation in axons. Elife 8:N/A (2019). PubMed: 31746735
- Shigeoka T et al. On-Site Ribosome Remodeling by Locally Synthesized Ribosomal Proteins in Axons. Cell Rep 29:3605-3619.e10 (2019). PubMed: 31825839