Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
    • Molecular weight
      31 kDa including tags
    • Amino acids
      228 to 277

Specifications

Our Abpromise guarantee covers the use of ab114838 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2 phospho D glycerate hydrol yase
    • 2 phospho D glycerate hydrolyase
    • 2-phospho-D-glycerate hydro-lyase
    • Beta enolase
    • Beta-enolase
    • ENO3
    • ENOB_HUMAN
    • Enolase 3
    • Enolase 3 (beta muscle)
    • Enolase3
    • GSD13
    • MSE
    • Muscle specific enolase
    • Muscle-specific enolase
    • Skeletal muscle enolase
    see all
  • Function
    Appears to have a function in striated muscle development and regeneration.
  • Tissue specificity
    The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
  • Pathway
    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 4/5.
  • Involvement in disease
    Defects in ENO3 are the cause of glycogen storage disease type 13 (GSD13) [MIM:612932]. A metabolic disorder that results in exercise-induced myalgias, generalized muscle weakness and fatigability. It is characterized by increased serum creatine kinase and decreased enolase 3 activity. Dramatically reduced protein levels with focal sarcoplasmic accumulation of glycogen-beta particles are detected on ultrastructural analysis.
  • Sequence similarities
    Belongs to the enolase family.
  • Developmental stage
    During ontogenesis, there is a transition from the alpha/alpha homodimer to the alpha/beta heterodimer in striated muscle cells, and to the alpha/gamma heterodimer in nerve cells.
  • Cellular localization
    Cytoplasm. Localized to the Z line. Some colocalization with CKM at M-band.
  • Information by UniProt

Images

  • ab114838 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114838 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114838.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up