Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSR LRELVPGVPRGTQLSQVEILQRVIDYILDLQVV
    • Molecular weight
      35 kDa including tags
    • Amino acids
      1 to 83

Specifications

Our Abpromise guarantee covers the use of ab114366 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1R21
    • bHLHb25
    • Class B basic helix-loop-helix protein 25
    • DNA binding protein inhibitor ID 3
    • DNA-binding protein inhibitor ID-3
    • HEIR 1
    • HEIR1
    • Helix loop helix protein HEIR 1
    • Helix loop helix protein HEIR1
    • Helix-loop-helix protein HEIR-1
    • HLH642
    • ID 3
    • ID like protein inhibitor HLH 1R21
    • ID like protein inhibitor HLH 462
    • ID-like protein inhibitor HLH 1R21
    • ID3
    • ID3_HUMAN
    • Inhibitor of DNA binding 3
    • Inhibitor of DNA binding 3 dominant negative helix loop helix protein
    see all
  • Function
    ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID-3 inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. May inhibit other transcription factors.
  • Tissue specificity
    Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114366 at approximately 34.76kDa stained with Coomassie Blue.

References

ab114366 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114366.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up