Recombinant Human IL5RA protein (Fc Chimera) (ab83828)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKIN APKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYF LYYRYGSWTEECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSK HSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEKPVSAFPIHCF DYEVKIHNTRNGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAG LW
    • Molecular weight
      62 kDa including tags
    • Amino acids
      21 to 322
    • Additional sequence information
      Chimeric Protein: A DNA sequence (aa 21-322) was fused to the Fc region of human IgG1 (aa 93-330).

Associated products

Specifications

Our Abpromise guarantee covers the use of ab83828 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes

    Molecular mass: Chimera migrates as a broad band between 70 and 80 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares

    with the unmodified Chimera that has a predicted molecular mass of 62.1 kDa. The final cellular processed form of the protein is expected to be 301 amino acids in length.

    pI: Chimera separates into a number of isoforms with a pI between 5.8 and 7.0 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified Chimera that has a predicted pI of 6.34.

    Chimera consists of 10-25% carbohydrate by weight.

    Chimera has N-linked and O-linked oligosaccharides.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Reconstitute for long term storage.

    Constituents: 89% PBS, 10% Trehalose, 1% Human serum albumin

  • Reconstitution
    It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • CD125
    • CD125 antigen
    • CDw125
    • HSIL5R3
    • IL-5 receptor subunit alpha
    • IL-5R subunit alpha
    • IL-5R-alpha
    • IL-5RA
    • IL5R
    • IL5RA
    • IL5RA_HUMAN
    • Interleukin 5 Receptor alpha
    • Interleukin 5 Receptor alpha chain
    • Interleukin 5 receptor alpha subunit
    • Interleukin 5 receptor subunit alpha
    • Interleukin 5 receptor type 3
    • Interleukin-5 receptor subunit alpha
    • MGC26560
    see all
  • Function
    This is the receptor for interleukin-5. The alpha chain binds to IL5.
  • Tissue specificity
    Expressed on eosinophils and basophils.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 5 subfamily.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 1D SDS-PAGE of ab83828 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab83828
    Lane 2: ab83828 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab83828 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    10 μg protein loaded per lane; Deep Purple™ stained.
  • A sample of ab83828 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. 40 μg protein loaded per lane; Deep Purple™ stained.
  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified Human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.

References

ab83828 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab83828.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up