Recombinant Human MAP1LC3A protein (ab190437)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKT KFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYE QEKDEDGFLYMVYASQETFG
    • Molecular weight
      14 kDa including tags
    • Amino acids
      1 to 120
    • Additional sequence information
      N-terminal HA tag; AMC C-terminal derivative (NP_115903).

Specifications

Our Abpromise guarantee covers the use of ab190437 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 6.5
    Constituents: 1.19% HEPES, 0.58% Sodium chloride, 10% Glycerol

General Info

  • Alternative names
    • ATG8E
    • Autophagy-related protein LC3 A
    • Autophagy-related ubiquitin-like modifier LC3 A
    • LC3
    • LC3A
    • MAP1 light chain 3 like protein 1
    • MAP1 light chain 3-like protein 1
    • MAP1A/1B light chain 3 A
    • MAP1A/MAP1B LC3 A
    • MAP1A/MAP1B light chain 3 A
    • MAP1ALC3
    • MAP1BLC3
    • Map1lc3a
    • Microtubule associated proteins 1A/1B light chain 3
    • Microtubule-associated protein 1 light chain 3 alpha
    • Microtubule-associated proteins 1A and 1B, light chain 3
    • Microtubule-associated proteins 1A/1B light chain 3A
    • MLP3A_HUMAN
    see all
  • Function
    Probably involved in formation of autophagosomal vacuoles (autophagosomes).
  • Tissue specificity
    Most abundant in heart, brain, liver, skeletal muscle and testis but absent in thymus and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the MAP1 LC3 family.
  • Post-translational
    modifications
    The precursor molecule is cleaved by APG4B/ATG4B to form the cytosolic form, LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II.
  • Cellular localization
    Cytoplasm > cytoskeleton. Endomembrane system. Cytoplasmic vesicle > autophagosome membrane. LC3-II binds to the autophagic membranes.
  • Information by UniProt

References

ab190437 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190437.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up