Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FPRLPDPQALFPARRRPPEFPGRPTTLTFAPRPRPAASRPRLDPWKLVSF GRTLTISPPSRPDTPESPGPPSVQPTLLDMDMEGQNQDSTVPLCGAHGSH
    • Molecular weight
      37 kDa including tags
    • Amino acids
      855 to 954

Specifications

Our Abpromise guarantee covers the use of ab116847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • M3K10_HUMAN
    • MAP3K 10
    • Map3k10
    • MEKK10
    • Mitogen activated protein kinase kinase kinase 10
    • Mitogen-activated protein kinase kinase kinase 10
    • Mixed lineage kinase 2
    • MKN28 derived nonreceptor type serine/threonine kinase
    • MKN28 kinase
    • MLK 2
    • MST
    • Protein kinase MST
    see all
  • Function
    Activates the JUN N-terminal pathway.
  • Tissue specificity
    Expressed in brain and skeletal muscle.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications
    Autophosphorylation on serine and threonine residues within the activation loop plays a role in enzyme activation.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116847 at approximately 36.63 kDa.

References

ab116847 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up