Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSRF KRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDL
    • Molecular weight
      35 kDa including tags
    • Amino acids
      222 to 308

Specifications

Our Abpromise guarantee covers the use of ab112437 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • HMafA
    • Mafa
    • MAFA_HUMAN
    • Pancreatic beta cell specific transcriptional activator
    • Pancreatic beta-cell-specific transcriptional activator
    • RIPE3b1
    • Transcription factor MafA
    • Transcription factor RIPE3b1
    • v maf musculoaponeurotic fibrosarcoma oncogene homolog A
    • v maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian)
    • V-maf musculoaponeurotic fibrosarcoma oncogene homolog A
    see all
  • Function
    Acts as a transcriptional factor. Specifically binds the insulin enhancer element RIPE3b and activates insulin gene expression. Cooperates synergistically with NEUROD1 and PDX1. Phosphorylation by GSK3 increases its transcriptional activity and is required for its oncogenic activity. Involved either as an oncogene or as a tumor suppressor, depending on the cell context.
  • Sequence similarities
    Belongs to the bZIP family. Maf subfamily.
    Contains 1 bZIP domain.
  • Post-translational
    modifications
    Ubiquitinated, leading to its degradation by the proteasome.
    Ser-14 and Ser-65 appear to be the major phosphorylation sites. Phosphorylated by MAPK13 on serine and threonine residues (Probable). Phosphorylation by GSK3 requires prior phosphorylation of Ser-65 by another kinase. Phosphorylation proceeds then from Ser-61 to Thr-57, Thr-53 and Ser-49. GSK3-mediated phosphorylation increases its transcriptional activity through the recruitment of the coactivator PCAF, is required for its transforming activity and leads to its degradation through an ubiquitin/proteasome-dependent pathway.
  • Cellular localization
    Nucleus. Detected in nuclei of pancreas islet beta cells.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab112437 at approximately 35.2kDa stained with Coomassie Blue.

References

ab112437 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112437.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up