Recombinant Human Pleckstrin protein (ab116861)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQS VRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFP DSGFFCEENS
    • Molecular weight
      38 kDa including tags
    • Amino acids
      121 to 230

Specifications

Our Abpromise guarantee covers the use of ab116861 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ27168
    • OTTHUMP00000159962
    • p47
    • Platelet 47 kDa protein
    • Platelet and leukocyte C kinase substrate
    • Platelet P47
    • Platelet p47 protein
    • Pleckstrin
    • PLEK
    • PLEK_HUMAN
    see all
  • Function
    Major protein kinase C substrate of platelets.
  • Sequence similarities
    Contains 1 DEP domain.
    Contains 2 PH domains.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116861 at approximately 37.73 kDa.

References

ab116861 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116861.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up