Recombinant Human Werner's syndrome helicase WRN protein (ab112372)
Key features and details
- Expression system: Wheat germ
- Suitable for: WB, ELISA, SDS-PAGE
Description
-
Product name
Recombinant Human Werner's syndrome helicase WRN protein -
Biological activity
useful for Antibody Production and Protein Array -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
NPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNK RRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKL MDKTKRGGLFS -
Predicted molecular weight
38 kDa including tags -
Amino acids
1322 to 1432
-
Specifications
Our Abpromise guarantee covers the use of ab112372 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
SDS-PAGE
-
Form
Liquid -
Additional notes
This product is useful for Antibody Production and Protein Array.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
Glutathione is reduced
General Info
-
Alternative names
- DKFZp686C2056
- DNA helicase
- DNA helicase, RecQ like type 3
see all -
Function
Multifunctional enzyme that has both magnesium and ATP-dependent DNA-helicase activity and 3'->5' exonuclease activity towards double-stranded DNA with a 5'-overhang. Has no nuclease activity towards single-stranded DNA or blunt-ended double-stranded DNA. Binds preferentially to DNA substrates containing alternate secondary structures, such as replication forks and Holliday junctions. May play an important role in the dissociation of joint DNA molecules that can arise as products of homologous recombination, at stalled replication forks or during DNA repair. Alleviates stalling of DNA polymerases at the site of DNA lesions. Important for genomic integrity. Plays a role in the formation of DNA replication focal centers; stably associates with foci elements generating binding sites for RP-A. -
Involvement in disease
Defects in WRN are a cause of Werner syndrome (WRN) [MIM:277700]. WRN is a rare autosomal recessive progeroid syndrome characterized by the premature onset of multiple age-related disorders, including atherosclerosis, cancer, non-insulin-dependent diabetes mellitus, ocular cataracts and osteoporosis. The major cause of death, at a median age of 47, is myocardial infarction. Currently all known WS mutations produces prematurely terminated proteins.
Defects in WRN may be a cause of colorectal cancer (CRC) [MIM:114500]. -
Sequence similarities
Belongs to the helicase family. RecQ subfamily.
Contains 1 3'-5' exonuclease domain.
Contains 1 helicase ATP-binding domain.
Contains 1 helicase C-terminal domain.
Contains 1 HRDC domain. -
Post-translational
modificationsPhosphorylated by PRKDC. Phosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Nucleus > nucleolus. Nucleus. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab112372 has not yet been referenced specifically in any publications.