Overview

Description

  • Nature
    Recombinant
  • Source
    Insect cells
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFK AVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACS FLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQ VLVGSEDYQSRHFACLPRNPGLCTWRSLGARHHHHHH
    • Molecular weight
      21 kDa including tags
    • Amino acids
      25 to 205
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Mature form of TIMP1 without signal peptide. NP_035723

Specifications

Our Abpromise guarantee covers the use of ab206786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab206786 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names
    • Clgi
    • Collagenase inhibitor
    • Collagenase inhibitor, Human
    • EPA
    • EPO
    • Erythroid Potentiating Activity
    • Erythroid-potentiating activity
    • Fibroblast collagenase inhibitor
    • FLJ90373
    • HCI
    • Human Collagenase Inhibitor
    • Metalloproteinase inhibitor 1
    • Metalloproteinase inhibitor 1 precursor
    • OTTHUMP00000023214
    • TIMP
    • TIMP 1
    • TIMP metallopeptidase inhibitor 1
    • TIMP-1
    • Timp1
    • TIMP1 protein
    • TIMP1_HUMAN
    • Tissue Inhibitor of Metalloproteinase 1
    • Tissue inhibitor of metalloproteinases
    • Tissue inhibitor of metalloproteinases 1
    • Ttissue inhibitor of metalloproteinase 1 erythroid potentiating activity collagenase inhibitor
    see all
  • Function
    Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Also mediates erythropoiesis in vitro; but, unlike IL-3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-11, MMP-12, MMP-13 and MMP-16. Does not act on MMP-14.
  • Sequence similarities
    Belongs to the protease inhibitor I35 (TIMP) family.
    Contains 1 NTR domain.
  • Post-translational
    modifications
    The activity of TIMP1 is dependent on the presence of disulfide bonds.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 μg of ab206786.

References

ab206786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up