Recombinant human Amphiregulin protein (ab104355)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 0.100 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies, WB
Description
-
Product name
Recombinant human Amphiregulin protein
See all Amphiregulin proteins and peptides -
Biological activity
Determined by its ability to stimulate the proliferation of mouse Balb/c 3T3 cells. The expected ED50 for this effect is 5-10 ng/ml. -
Purity
> 95 % SDS-PAGE.
Purity is > 95% by SDS-PAGE gel and HPLC analyses. Sterile filtered through a 0.2 micron filter. -
Endotoxin level
< 0.100 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEF QNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK -
Predicted molecular weight
11 kDa -
Amino acids
101 to 198
-
Specifications
Our Abpromise guarantee covers the use of ab104355 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
Western blot
-
Form
Lyophilized -
Additional notes
Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.
Constituent: 0.082% Sodium phosphate
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
General Info
-
Alternative names
- A REG
- Amphiregulin
- Amphiregulin B
see all -
Function
Bifunctional growth-modulating glycoprotein. Inhibits growth of several human carcinoma cells in culture and stimulates proliferation of human fibroblasts and certain other tumor cells. -
Sequence similarities
Belongs to the amphiregulin family.
Contains 1 EGF-like domain. -
Cellular localization
Membrane. - Information by UniProt
Images
-
Anti-Amphiregulin antibody [MM0089-8K16] (ab89119) at 1/500 dilution +
Recombinant human Amphiregulin protein (ab104355) at 0.1 µg
Secondary
Goat Anti-Mouse IgG H&L (HRP) preadsorbed (ab97040) at 1/5000 dilution
Developed using the ECL technique.
Performed under reducing conditions.
Exposure time: 8 minutesab89119 recognizes the recombinant full length soluble Human Amphiregulin protein (ab104355) which has an expected molecular weight of ~12 kDa.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab104355 has been referenced in 1 publication.
- Hobor S et al. TGFa and amphiregulin paracrine network promotes resistance to EGFR blockade in colorectal cancer cells. Clin Cancer Res 20:6429-38 (2014). PubMed: 24916700