Recombinant human CD40L protein (Soluble, Animal Free) (ab179625)

Overview

  • Product name
    Recombinant human CD40L protein (Soluble, Animal Free)
    See all CD40L proteins and peptides
  • Protein length
    Full length protein
  • Description
    Recombinant human CD40L protein (Soluble)

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLT VKRQGLYYIYAQVTFCSNREASSQAPFIASLWLKSPGRFERILLRAANTH SSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
    • Molecular weight
      16 kDa
    • Amino acids
      113 to 261
    • Additional sequence information
      Full length soluble form

Specifications

Our Abpromise guarantee covers the use of ab179625 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    HEK-blue™ CD40L Activity:  ED50 ≤50 ng/ml; ≥ 2.0 x 104 units/mg.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Endotoxin level
    <=1.000 Eu/µg
  • Purity
    >= 98 % SDS-PAGE.
    Also determined by HPCL and spectroscopy at 280 nm.
  • Form
    Lyophilised
  • Additional notes

    This product is produced with no animal-derived raw products, animal free equipment and animal free protocols.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 mg/mL, which can be further diluted into other aqueous solutions. It is recommended that a carrier protein (0.1% HSA or BSA) is added for long term storage.

General Info

  • Alternative names
    • CD 40L
    • CD154
    • CD40 antigen ligand
    • CD40 ligand
    • CD40 ligand, soluble form
    • CD40-L
    • CD40L
    • CD40L_HUMAN
    • CD40LG
    • gp39
    • hCD40L
    • HIGM1
    • IGM
    • IMD3
    • T B cell activating molecule
    • T BAM
    • T-cell antigen Gp39
    • TNF-related activation protein
    • TNFSF5
    • TrAP
    • Tumor necrosis factor (ligand) superfamily member 5
    • Tumor necrosis factor ligand superfamily member 5
    see all
  • Function
    Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL-4. Involved in immunoglobulin class switching.
    Release of soluble CD40L from platelets is partially regulated by GP IIb/IIIa, actin polymerization, and an matrix metalloproteinases (MMP) inhibitor-sensitive pathway.
  • Tissue specificity
    Specifically expressed on activated CD4+ T-lymphocytes.
  • Involvement in disease
    Defects in CD40LG are the cause of X-linked immunodeficiency with hyper-IgM type 1 (HIGM1) [MIM:308230]; also known as X-linked hyper IgM syndrome (XHIM). HIGM1 is an immunoglobulin isotype switch defect characterized by elevated concentrations of serum IgM and decreased amounts of all other isotypes. Affected males present at an early age (usually within the first year of life) recurrent bacterial and opportunistic infections, including Pneumocystis carinii pneumonia and intractable diarrhea due to cryptosporidium infection. Despite substitution treatment with intravenous immunoglobulin, the overall prognosis is rather poor, with a death rate of about 10% before adolescence.
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Post-translational
    modifications
    The soluble form derives from the membrane form by proteolytic processing.
    N-linked glycan is a mixture of high mannose and complex type. Glycan structure does not influence binding affinity to CD40.
    Not O-glycosylated.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

References

ab179625 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179625.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up