Recombinant human FKBP2 protein (ab93681)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human FKBP2 protein
See all FKBP2 proteins and peptides -
Biological activity
Specific activity is > 700nmol/min/mg, and is defined as the amount of enzyme that cleaves 1nmol of suc-AAPF-pNA per minute at 37°C in Tris-HCl pH 8.0 using chymotrypsin.
-
Purity
> 90 % SDS-PAGE.
ab93681 is purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSL PQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPK IPGGATLVFEVELLKIERRTEL
-
Specifications
Our Abpromise guarantee covers the use of ab93681 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.0154% DTT, 0.242% Tris, 10% Glycerol (glycerin, glycerine)This product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- 13 kDa FK506-binding protein
- 13 kDa FKBP
- EC 5.2.1.8
see all -
Function
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. -
Tissue specificity
T-cells and thymus. -
Sequence similarities
Belongs to the FKBP-type PPIase family. FKBP2 subfamily.
Contains 1 PPIase FKBP-type domain. -
Cellular localization
Endoplasmic reticulum membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab93681 has been referenced in 2 publications.
- Yoshikawa N et al. Role of FK506 Binding Protein on Tacrolimus Distribution in Red Blood Cells. Pharm Res 37:143 (2020). PubMed: 32661607
- Bielecka MK et al. Recombinant protein truncation strategy for inducing bactericidal antibodies to the macrophage infectivity potentiator protein of Neisseria meningitidis and circumventing potential cross-reactivity with human FK506-binding proteins. Infect Immun 83:730-42 (2015). PubMed: 25452551