Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • AccessionQ9NZQ7
    • SpeciesHuman
    • SequenceFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFV HGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISY GGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWT SSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEE NHTAELVIPELPLAHPPNER
    • Molecular weight26 kDa including tags
    • Amino acids19 to 238
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityMeasured by its ability to inhibit anti-CD3 antibody induced IL­2 secretion in human T lymphocytes. The ED50 for this effect is typically 0.6-5 µg/ml.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level< 1.000 Eu/µg
  • Purity>95% by SDS-PAGE .

  • FormLyophilised
  • Additional notes

    For a recombinant rabbit monoclonal antiody to PD-L1 in IHC usage and KO validated - see ab205921 (clone 28-8)

    For a recombinant rabbit monoclonal antiody to PD-L1 in WB and ICC/IF usage - see ab174838 (clone EPR1161(2))

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 99% PBS
    Note: Normally Mannitol or Trehalose are added as protectants before lyophilization.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • B7 H
    • B7 H1
    • B7 homolog 1
    • B7-H1
    • B7H
    • B7H1
    • CD 274
    • CD274
    • CD274 antigen
    • CD274 molecule
    • MGC142294
    • MGC142296
    • OTTHUMP00000021029
    • PD L1
    • PD-L1
    • PD1L1_HUMAN
    • PDCD1 ligand 1
    • PDCD1L1
    • PDCD1LG1
    • PDL 1
    • PDL1
    • Programmed cell death 1 ligand 1
    • Programmed death ligand 1
    • RGD1566211
    see all
  • FunctionInvolved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production.
  • Tissue specificityHighly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes.
  • Sequence similaritiesBelongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localizationCell membrane and Endomembrane system.
  • Information by UniProt

Recombinant human PD-L1 protein images

  • SDS-PAGE of reduced ab167713 stained overnight with Coomassie Blue.

References for Recombinant human PD-L1 protein (ab167713)

ab167713 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab167713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"