Recombinant human UCH37 protein (ab108375)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Active: Yes
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human UCH37 protein
See all UCH37 proteins and peptides -
Biological activity
Specific activity: > 500 pmole/min/ug. Measured by the hydrolysis of Ubiquitin-AMC at pH 8.0, at 37°C.
Activity Assay:- Prepare a 100ul of recombinant UCH-L5 protein with various concentrations (0.48ng, 0.9ng) in assay buffer and equilibrate to 37°C for 10 minutes. (Assay buffer: 50mM Tris-HCl, 0.5 mM EDTA, 1 mM DTT, 0.1 mg/ml Ovalbumin, pH 8.0.) Add 50ul of 1µM Ubiquitin-AMC.
- Read at excitation wavelengths 355nm and emission 460nm for 5 minutes.
- Ubiquitin-AMC
- 96 Well Polystyrene Microplate, black
- Fluorescent plate reader (PerkinElmer, VICTOR X3)
Specific activity: > 500 pmole/min/ug. Measured by the hydrolysis of Ubiquitin-AMC at pH 8.0, at 37°C.
Activity Assay:- Prepare a 100ul of recombinant UCH-L5 protein with various concentrations (0.48ng, 0.9ng) in assay buffer and equilibrate to 37°C for 10 minutes. (Assay buffer: 50mM Tris-HCl, 0.5 mM EDTA, 1 mM DTT, 0.1 mg/ml Ovalbumin, pH 8.0.) Add 50ul of 1µM Ubiquitin-AMC.
- Read at excitation wavelengths 355nm and emission 460nm for 5 minutes.
- Ubiquitin-AMC
- 96 Well Polystyrene Microplate, black
- Fluorescent plate reader (PerkinElmer, VICTOR X3)
-
Purity
> 90 % SDS-PAGE.
ab108375 is purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMTGNAGEWCLMESDPGVFTELIKGFGCRGA QVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFA KQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLAL SNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDG LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMI YEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKR YKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK -
Predicted molecular weight
40 kDa including tags -
Amino acids
1 to 329 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab108375 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.00174% PMSF, 0.077% DTT, 0.316% Tris HCl, 0.0584% EDTA, 30% Glycerol (glycerin, glycerine), 1.16% Sodium chlorideThis product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- UCH37
- AD-019
- CGI 70
see all -
Function
Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. -
Sequence similarities
Belongs to the peptidase C12 family. -
Cellular localization
Cytoplasm. Nucleus. Associates with the proteasome 19S subunit in the cytoplasm. Associates with the INO80 complex in the nucleus. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab108375 has not yet been referenced specifically in any publications.