Recombinant mouse NGF protein (Animal Free) (ab222367)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 0.050 Eu/µg
- Active: Yes
- Suitable for: Functional Studies
Description
-
Product name
Recombinant mouse NGF protein (Animal Free)
See all NGF proteins and peptides -
Biological activity
The activity as determined by the proliferation of TF-1 cells and is typically less than 1 ng/ml. This corresponds to an expected specific activity of 1 x 106 units/mg.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 0.050 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Mouse -
Sequence
MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVF RQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAW RFIRIDTACVCVLSRKATRRG -
Predicted molecular weight
14 kDa -
Amino acids
122 to 241 -
Additional sequence information
This product is the mature full length protein from aa 122 to 241. The signal peptide and propeptide are not included. Homodimer.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab222367 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: 0.1% Trifluoroacetic acid
Lyophilized from a sterile filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge vial before opening. Suspend the product by gently pipetting sterile deionized water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaw.
General Info
-
Alternative names
- Beta nerve growth factor
- Beta NGF
- Beta-nerve growth factor
see all -
Function
Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI (PubMed:20164177). -
Involvement in disease
Neuropathy, hereditary sensory and autonomic, 5 -
Sequence similarities
Belongs to the NGF-beta family. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Functional analysis of ab222367
-
SDS PAGE analysis of ab222365 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab222367 has not yet been referenced specifically in any publications.