Recombinant rat CXCL1/GRO alpha protein (ab9773)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, WB
Description
-
Product name
Recombinant rat CXCL1/GRO alpha protein
See all CXCL1/GRO alpha proteins and peptides -
Purity
> 98 % SDS-PAGE.
Endotoxin level is less than 0.1 ng per g (1EU/g). -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
APVANELRCQCLQTVAGIHFKNIQSLKVMP PGPHCTQTEVIATLKNGREACLDPEAPMVQ KIVQKMLKGVPK -
Predicted molecular weight
11 kDa -
Amino acids
25 to 96
-
Specifications
Our Abpromise guarantee covers the use of ab9773 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
Western blot
-
Form
Lyophilized -
Additional notes
The maximal chemotactic activity of rat CXCL1/GRO alpha on rat neutrophils was determined by its ability to chemoattract rat neutrophils using a concentration range of 10.0-100.0 ng/ml.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.
General Info
-
Alternative names
- C-X-C motif chemokine 1
- chemokine (C-X-C motif) ligand 1
- Chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
see all -
Function
Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. -
Sequence similarities
Belongs to the intercrine alpha (chemokine CxC) family. -
Post-translational
modificationsN-terminal processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) are produced by proteolytic cleavage after secretion from peripheral blood monocytes. -
Cellular localization
Secreted. - Information by UniProt
Images
-
All lanes : Anti-CXCL1/GRO alpha antibody (ab86436) at 0.5 µg/ml
Lane 1 :Recombinant rat CXCL1/GRO alpha protein (ab9773) at 0.1 µg
Lane 2 :Recombinant rat CXCL1/GRO alpha protein (ab9773) at 0.01 µg
Secondary
All lanes : Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
Developed using the ECL technique.
Performed under reducing conditions.
Exposure time: 1 minute
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab9773 has not yet been referenced specifically in any publications.