If your product does not perform as described on this datasheet, we will refund or replace your product...
Read our guarantee »This product is covered by the Abpromise guarantee. Our scientific support team are available to answer any questions or queries - fill out an inquiry form for ab37657 for help.
Alternatively, you can search the previous enquiries about this product to see if your query has already been answered.
|
|||||||||
|
|||||||||
Dear , This customer advanced an enquiry about ab37657 and ab50250. He would like to conduct the non-conventional application, and he wants to know which antibody (ab37657 or ab50250) can be used to pair with the antigen ab103393. Would you please help this customer to solve this problem? Thanks for your kindly assistance. Best regards |
|||||||||
ANSWER: |
Thank you for your reply and for kindly confirming these details. No problem, I wanted to ensure I had the correct information so I could provide an accurate answer for you.
I can confirm the following details regarding these products:
ab103393 S100A12 protein: Recombinant full length Human S100A12 (amino acids 2-92)
ab37657: The antibody is likely to detect ab103393 S100A12 protein, since the protein seuqence almost completely overlaps with the human S100A12 immunogen sequence for this antibody: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
ab50250 is a monoclonal raised against the whole length protein. I am sorry the epitope for this has not been mapped. However as it has been rasied against whole protein, I would suggest it should detect the full length recombinant protein.
I would recommend also to consider that the protein ab103393 has a his tag. There is a small possibility the tag may interfere with antibody binding, and I am sorry we have no data to guarantee that the his tag will not prevent the binding of ab37657 or ab50250. I am sorry we have no other S100A12 proteins without his tag for you to try on this occasion.
I hope this information will be helpful to you. Should you have any further questions, please do not hesitate to contact us. |
||||||||
|
|||||||||
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
Anti-S100A12 antibody (ab37657) + 200 ng recombinant human S100A12
Secondary
anti-rabbit IgG alkalind phosphatase conjugate
Predicted band size : 10.5 kDa
Observed band size : 10.5 kDa
Additional bands at : 21 kDa (possible dimer).
Anti-S100A12 antibody (ab37657) detects macrophage infiltrates expressing S100A12 in colon tissues from a patient with Crohn’s disease.
0
Call 01223 696 000 or contact us