You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameS100A9 protein (Tagged-His Tag)See all S100A9 proteins and peptides ...
  • Protein descriptionRecombinant full length Human S100A9 protein (114 amino acids) with an N terminal His tag. Predicted MWt: 13 kDa; UniProt ID: P06702.
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitution with 157 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Sequence notesMTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKEL VRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEE FI MLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab91727 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
  • Application notesSDS-PAGE: Use at an assay dependent dilution.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        Leukocyte L1 complex heavy chain60B8AGCAGB
        Calgranulin BCalgranulin-BCalprotectin L1H subunitCFAGCGLBL1AGLeukocyte L1 complex heavy chainLIAGMAC387MIFMigration inhibitory factor related protein 14Migration inhibitory factor-related protein 14MRP 14MRP-14MRP14NIFOTTHUMP00000015331P14Protein S100-A9S100 A9S100 calcium binding protein A9S100 calcium binding protein A9 calgranulin BS100 calcium-binding protein A9S100A9S10A9_HUMAN
      see all
  • FunctionCalcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS) (By similarity). Promotes tubulin polymerization when unphosphorylated. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as a pro-inflammatory mediator in acute and chronic inflammation and up-regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions.
  • Tissue specificityExpressed by macrophages in acutely inflammed tissues and in chronic inflammation. Detected in peripheral blood leukocytes, in neutrophils and granulocytes. Detected at sites of vascular inflammation (at protein level). Also expressed in epithelial cells constitutively or induced during dermatoses.
  • Sequence similaritiesBelongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Post-translational
    modifications    Phosphorylated. Phosphorylation inhibits activation of tubulin polymerization.
  • Cellular localizationSecreted. Cytoplasm. Cytoplasm > cytoskeleton. Cell membrane. Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM-CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes. Serum levels are high in patients suffering from chronic inflammation.

    • Target information above from: UniProt accession P06702 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    S100A9 protein (Tagged-His Tag) images

    • SDS-PAGE - S100A9 protein (Tagged-His Tag) (ab91727)
      SDS-PAGE - S100A9 protein (Tagged-His Tag) (ab91727)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for S100A9 protein (Tagged-His Tag) (ab91727)

    ab91727 has not yet been referenced specifically in any publications.

    Publishing research using ab91727 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab91727 Submit a Question for ab91727

    There are currently no Abreviews or Questions for ab91727.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"