You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameSDHB protein (Tagged-His Tag)See all SDHB proteins and peptides ...
  • Protein descriptionRecombinant full length protein, corresponding to amino acids 1-280 of Human SDHB with N terminal His tag, MWt 35kDa (UniProt P21912).
  • Expression hostE. coli
  • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 96 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Sequence notesMAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIK KFAIYRWDP DKAGDKPHMQTYEVDLNKCGPMVLDALIK IKNEVDSTLTFRRSCREGIC GSCAMNINGGNTLACTRR IDTNLNKVSKIYPLPHMYVIKDLVPDLSNFY AQYKSIE PYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCST SC PSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLA KLQDPFSLYRCHT IMNCTRTCPKGLNPGKAIAEIKKMM ATYKEKKASV
  • Research Areas
  • Applications

    Our Abpromise guarantee covers the use of ab91959 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
    MS
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Protein info

    • Alternative names
        DHSB_HUMANFLJ92337IP
        Iron sulfur subunitIron sulfur subunit of complex IIIron-sulfur subunit of complex IImitochondrialOTTHUMP00000044624PGL 4PGL4SDHSDH 1SDH1SDH2SDHBSDHIPSuccinate dehydrogenase [ubiquinone] iron sulfur protein mitochondrialSuccinate dehydrogenase [ubiquinone] iron-sulfur subunitsuccinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrialSuccinate Dehydrogenase 1 Iron Sulfur SubunitSuccinate dehydrogenase complex subunit B iron sulfurSuccinate Dehydrogenase Complex Subunit B Iron Sulfur Proteinsuccinate dehydrogenase complex, subunit B, iron sulfur (Ip)Succinate dehydrogenase iron sulfur protein
      see all
  • FunctionIron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
  • PathwayCarbohydrate metabolism; tricarboxylic acid cycle; fumarate from succinate (eukaryal route): step 1/1.
  • Involvement in diseaseDefects in SDHB are a cause of susceptibility to pheochromocytoma (PCC) [MIM:171300]. A catecholamine-producing tumor of chromaffin tissue of the adrenal medulla or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of epinephrine and norepinephrine, is hypertension, which may be persistent or intermittent.
    Defects in SDHB are the cause of hereditary paragangliomas type 4 (PGL4) [MIM:115310]; also known as familial non-chromaffin paragangliomas type 4. Paragangliomas refer to rare and mostly benign tumors that arise from any component of the neuroendocrine system. PGL4 is characterized by the development of mostly benign, highly vascular, slow growing tumors in the head and neck. In the head and neck region, the carotid body is the largest of all paraganglia and is also the most common site of the tumors.
    Defects in SDHB are a cause of paraganglioma and gastric stromal sarcoma (PGGSS) [MIM:606864]; also called Carney-Stratakis syndrome. Gastrointestinal stromal tumors may be sporadic or inherited in an autosomal dominant manner, alone or as a component of a syndrome associated with other tumors, such as in the context of neurofibromatosis type 1 (NF1). Patients have both gastrointestinal stromal tumors and paragangliomas. Susceptibility to the tumors was inherited in an apparently autosomal dominant manner, with incomplete penetrance.
    Defects in SDHB are a cause of Cowden-like syndrome (CWDLS) [MIM:612359]. Cowden-like syndrome is a cancer predisposition syndrome associated with elevated risk for tumors of the breast, thyroid, kidney and uterus.
  • Sequence similaritiesBelongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.
    Contains 1 2Fe-2S ferredoxin-type domain.
    Contains 1 4Fe-4S ferredoxin-type domain.
  • Cellular localizationMitochondrion inner membrane.
  • Target information above from: UniProt accession P21912 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    SDHB protein (Tagged-His Tag) images

    • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for SDHB protein (Tagged-His Tag) (ab91959)

    ab91959 has not yet been referenced specifically in any publications.

    Product Wall

    There are currently no Abreviews or Questions for ab91959.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"